Recombinant Human Traf Family Member-Associated Nf-Kappa-B Activator (TANK) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09556P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Traf Family Member-Associated Nf-Kappa-B Activator (TANK) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09556P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Traf Family Member-Associated Nf-Kappa-B Activator (TANK) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q92844 |
| Target Symbol | TANK |
| Synonyms | I TRAF; I-TRAF; ITRAF; Tank; TANK_HUMAN; TRAF family member associated NF KAPPA B activator; TRAF family member associated NFKB activator; TRAF family member-associated NF-kappa-B activator; TRAF interacting protein; TRAF interacting protein TANK isoform a; TRAF interacting protein TANK isoform b; TRAF-interacting protein; TRAF2 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR |
| Expression Range | 1-119aa |
| Protein Length | Partial |
| Mol. Weight | 15.8kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. Negatively regulates NF-kappaB signaling and cell survival upon DNA damage. Plays a role as an adapter to assemble ZC3H12A, USP10 in a deubiquitination complex which plays a negative feedback response to attenuate NF-kappaB activation through the deubiquitination of IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage. Promotes UBP10-induced deubiquitination of TRAF6 in response to DNA damage. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. |
| Subcellular Location | Cytoplasm. |
| Database References | HGNC: 11562 OMIM: 603893 KEGG: hsa:10010 STRING: 9606.ENSP00000259075 UniGene: PMID: 28566380 |
