Recombinant Human Tomoregulin-2 (TMEFF2) Protein (His), Active

Name: Recombinant Human Tomoregulin-2 (TMEFF2) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05725P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody , the EC 50 is 2.129-2.956 ng/mL.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tomoregulin-2 (TMEFF2) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody , the EC50 is 2.129-2.956 ng/mL.
Uniprotkb	Q9UIK5
Target Symbol	TMEFF2
Synonyms	(TR-2)(Hyperplastic polyposis protein 1)(Transmembrane protein with EGF-like and two follistatin-like domains)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-10His
Target Protein Sequence	FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV
Expression Range	41-320aa
Protein Length	Partial
Mol. Weight	32.3 kDa
Research Area	Other
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Subcellular Location	[Isoform 1]: Membrane; Single-pass type I membrane protein.; [Isoform 2]: Membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted.
Protein Families	Tomoregulin family
Database References	HGNC: 11867 OMIM: 605734 KEGG: hsa:23671 STRING: 9606.ENSP00000272771 UniGene: PMID: 28762604 TMEFF2 methylation is associated with clear cell renal cell carcinoma. PMID: 28128743 Results suggest that TMEFF2 is a brain-enriched endogenous modulator of Abeta neurotoxicity and an enhancer of alpha-secretase processing of AbetaPP PMID: 26402097 TMEFF2 regulates the non-canonical activin/BMP4 signaling, PI3K, and Ras/ERK1/2 pathways. PMID: 25573902 c-Myc contributes to the epigenetic regulation of HPP1 via the dominant recruitment of HDAC3. PMID: 24919179 TMEFF2 acts as a tumor suppressor in gastric cancer through direct interaction with SHP-1 and can be a potential biomarker of carcinogenesis. PMID: 24987055 TMEFF2 and SARDH cooperate to modulate one-carbon metabolism and invasion of prostate cancer cells. PMID: 23824605 Androgen signaling promotes eIF2alpha phosphorylation and subsequent translation of TMEFF2 via a mechanism that requires uORFs in the 5'-UTR of TMEFF2. PMID: 23405127 Methylation of TMEFF2 gene is associated with colorectal neoplasia in ulcerative colitis and Crohn's colitis. PMID: 22532293 Findings suggest that methylation-associated down-regulation of TMEFF2 gene may be involved in lung tumorigenesis and TMEFF2 methylation can serve as a specific blood-based biomarker for NSCLC. PMID: 22814847 Several genes expressed at exceptionally high levels were identified associated with early oocyte development, TMEFF2, the Rho-GTPase-activating protein oligophrenin 1 (OPHN1) and the mitochondrial-encoded ATPase6 (ATP6). PMID: 22238370 TMEFF2 can function to regulate PDGF signaling; it is hypermethylated and downregulated in glioma and several other cancers PMID: 21559523 the tumor suppressor activity of TMEFF2 requires the cytoplasmic/transmembrane portion of the protein and correlates with its ability to bind to SARDH and to modulate the level of sarcosine. PMID: 21393249 GDF15, HSPA2, TMEFF2, and VIM were identified as epigenetic biomarkers for Bladder cancer. PMID: 20975101 Hypermethylation of HPP1 is associated with hMLH1 hypermethylation in gastric adenocarcinomas. PMID: 12384516 Aberrant methylation of the HPP1 gene is a relative common early event in ulcerative colitis-associated colorectal carcinoma. PMID: 12460892 inverse correlation between TMEFF2 and c-Myc expression PMID: 12729735 Hypermethylation of p16, RUNX3, and HPP1 in Barreett exophagus may represent independent risk factors for the progression of Barrett esophagus to esophageal cancer. PMID: 15824739 A secreted form of TMEFF2 is expressed from TMEFF2 locus and may functionally interact with full-length TMEFF2, or its binding partners, and may also influence current immune-based treatment strategies PMID: 16439095 Hypermethylation of HPP1 is associated with primary adenocarcinomas of the small bowel PMID: 16619216 Methylation testing of fecal DNA using a panel of epigenetic markers (methylated SFRP2, HPP1 and MGMT) may be a simple and promising non-invasive screening method for colorectal carcinoma and precancerous lesions. PMID: 17352030 TMEFF2 contributes to cell proliferation in an ADAM17-dependent autocrine fashion in cells expressing this protein PMID: 17942404 data provides evidence to support the role of HPP1 as a tumor suppressor gene; activation of the STAT1 pathway likely represents the principal mediator of HPP1's tumor suppressive properties PMID: 18059030 Methylated PAX6- or TPEF-promoters could represent biomarkers for bladder cancer. PMID: 18070176 Distinct TPEF/HPP1 (transmembrane protein containing epidermal growth factor) gene methylation patterns in gastric cancer indicate a field effect in gastric carcinogenesis. PMID: 18799374 promoter of TPEF gene is frequently hpermethylated, and associated with loss of TPEF mRNA expression in esophageal squamous cell carcinoma PMID: 19040536 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma. PMID: 19288010 Analysis of DNA from peripheral blood revealed that TPEF methylation was detectable in colorectal tumor patients and patients with early or pre-neoplastic lesions, but not in healthy volunteers. PMID: 15068392

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.