Recombinant Human Toll-Like Receptor 4 (TLR4) Protein (His)

Name: Recombinant Human Toll-Like Receptor 4 (TLR4) Protein (His)
Brand: Beta LifeScience
SKU: BLC-06145P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Toll-Like Receptor 4 (TLR4) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O00206
Target Symbol	TLR4
Synonyms	ARMD10; CD284; CD284 antigen; ESOP 1; ESOP1; Homolog of Drosophila toll; hToll; LY 96; LY96; Lymphocyte antigen 96; md 2; MD 2 protein; MD2 protein; Myeloid differentiation protein 2; Protein MD 2; Protein MD2; TLR 4; TLR4; TLR4_HUMAN; TOLL; Toll like receptor 4; Toll-like receptor 4
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-6His
Target Protein Sequence	EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
Expression Range	27-631aa
Protein Length	Partial
Mol. Weight	69.8
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni(2+). Responses triggered by Ni(2+) require non-conserved histidines and are, therefore, species-specific. Both M.tuberculosis HSP70 (dnaK) and HSP65 (groEL-2) act via this protein to stimulate NF-kappa-B expression. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-). Stimulation of monocytes in vitro with M.tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via TLR2, but also partially via this receptor. Activated by the signaling pathway regulator NMI which acts as damage-associated molecular patterns (DAMPs) in response to cell injury or pathogen invasion, therefore promoting nuclear factor NF-kappa-B activation.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Early endosome. Cell projection, ruffle.
Protein Families	Toll-like receptor family
Database References	HGNC: 11850 OMIM: 603030 KEGG: hsa:7099 STRING: 9606.ENSP00000363089 UniGene: PMID: 30204113 high expression of (TLR4) is associated with Type 2 diabetes mellitus. PMID: 30403590 Data suggest that the toll-like receptor 4 (TLR4) mutant-specific conformational alterations may help in deciphering the mechanism of loss-of-function mutations. PMID: 28272553 TLR4 and TLR9 mRNA were elevated in blood samples from celiac disease patients compared to the healthy controls PMID: 30057921 high TLR4 expression level during acute rejection was associated with adverse kidney allograft outcome PMID: 29475090 the results of the present study showed significantly higher mRNA expression levels for TLR4 180days post-transplantation in the graft dysfunction group compared to well functioning graft group PMID: 29452169 the expression levels of TLR4/MyD88 were positively correlated with the metastatic potential of breast cancer cells and tumors. The expression levels of TLR4/MyD88 may be used as a biomarker to evaluate the prognosis and guide the treatment of patients with breast cancer. PMID: 30066873 These results suggest that celastrol exerts its protective effect partly via inhibiting the TLR4mediated immune and inflammatory response in steatotic HepG2 cells. PMID: 30015859 No association between the SNPs rs10983755 A/G, rs4986791 C/T, rs4986790 A/G, rs10759932 C/T, rs1927911 C/T, rs11536889 C/G, and rs12377632 C/T and heart transplant rejection was found PMID: 30177119 The results revealed that TLR4 and COX-2 were upregulated in PCa tissues; silencing of TLR4 or COX-2 inhibited PCa cell proliferation, migration, and invasion. PMID: 30098292 The role of IDO1-IDO2-AHR pathway in the TLR4-induced tolerogenic phenotype in human dendritic cells has been reported. PMID: 28256612 TLR4 Asp299Gly polymorphism potentially leading to the development of recurrent hydatidosis, by skewing the immune system towards a Th2 response PMID: 29602972 Study demonstrated that HMGB1 and TLR4 could contribute to the inflammatory lichen planus process in skin. PMID: 29728859 Physical interaction between p38 and eNOS was demonstrated by immunoprecipitation, suggesting a novel, NO-independent mechanism for eNOS regulation of TLR4. In correlation, biopsy samples in patients with systemic lupus erythematous showed reduced eNOS expression with associated elevations in TLR4 and p38, suggesting an in vivo link. PMID: 29061842 The overexpression of miR-140 inhibited the upregulation of the expression of TLR4. PMID: 29901170 TLR4 small interfering RNA blocked hUGT1A1/hNRs downregulation. PMID: 29311138 The expression of TLR4 in perihematoma tissue began to increase within 6 hours after intracerebral hemorrhage and decreased after 72 hours. PMID: 29990607 miR-20a could negatively regulate TLR4 and NLRP3 signaling to protect human aortic endothelial cells from inflammatory injuries. PMID: 29653364 Study provides clear evidence that resistin is a clinically relevant endogenous ligand for TLR4, which promotes tumor progression via TLR4/NF-kappaB/STAT3 signaling. PMID: 28991224 The antitumor effect of curcumin was related to the inhibition HSP70-TLR4 signaling. PMID: 29901164 Activates the NFkappaB pathway through the Tolllike receptor 4 (TLR4)/myeloid differentiation factor 88 (MyD88)/IkappaBalpha axis. PMID: 29916535 An MRP-TLR4 dependent signaling may play an important role in the pathogenesis of autoimmune thyroid diseases. PMID: 29656212 The pathways involved in the effect of ROCK1 in human corneal epithelial cells was preliminarily explained by detecting changes of TLR4-mediated NF-kB and ERK signaling. PMID: 29804125 Serum TLR4 was closely related to AA and associated with some AA-related circulating markers PMID: 29649455 Fibrinogen induced podocyte injury via the TLR4-p38 MAPK-NF-kappaB p65 pathway in focal segmental glomerulosclerosis. PMID: 28407405 Crosstalk between TLR4 and Notch1 signaling regulates the inflammatory response in the IgAN and maybe plays an important role in the progression of IgAN. PMID: 29230705 Data indicate three sites within tenascin-C that directly and cooperatively interact with toll-like receptor 4 (TLR4). PMID: 29150600 Low TLR4 expression is associated with pancreatic ductal adenocarcinoma. PMID: 30246618 An association exists between P. gingivalis and P. intermedia with increased TLR-4 and NF-kappaB expression in the placenta of pre-eclamptic women with periodontitis. PMID: 28349674 TLR4 SNPs were not associated with acute graft rejection in kidney transplant recipients. PMID: 28411360 TLR4 Thr399Ile polymorphism was associated with increased risk of Crohn's disease in Asia and Asians. [meta-analysis] PMID: 29421805 Our results indicated TLR4 SNP rs11536889 may be a marker for intracranial aneurysm risk PMID: 29754966 the expression of TLR4 in gingival tissues and on mast cells increased with the severity of chronic periodontitis, suggesting that TLR4, particularly mast cell TLR4, may be important in the disease process of human chronic periodontitis. PMID: 29488617 Report shows that rheumatoid arthritis (RA) patients express functional TLR4 on peripheral CD8+ T cells that directly promote T-cell function and differentiation to Tc1. The study also suggests that TLR4 signals directly drive Tc1 development and T cell activation independent of TCR engagement. PMID: 28424490 Resistin promoted lung adenocarcinoma metastasis through the TLR4/Src/EGFR/PI3K/NF-kappaB pathway. PMID: 29927028 imcreased TLR4 expression in gastric cardia lesions may be associated with gastric cardia cancer tumorigenesis PMID: 29670922 The immunoenhancement effect of PSP against lung cancer is mediated by TLR4-MAPK/NF-kappaB signaling pathways PMID: 29343453 LPS stimulation induced TLR4 expression and increased pigmentation. TLR4 expression was not detected after single-dose UVA or UVB treatment, but pigmentation increased. Repeated UV treatment induced TLR4 expression and increased pigmentation. LPS stimulation and repeated UV treatment increased IL-6 secretion, and repeated UVB treatment increased IL-10 secretion. PMID: 29063638 data suggest that high-phosphate conditions directly induce vascular calcification via the activation of TLR4/NF-kappaB signaling in VSMCs PMID: 29227975 LncRNA MEG3 ameliorates respiratory syncytial virus infection by suppressing TLR4 signaling. PMID: 29257348 Study shows that the toll-like receptor 4 gene rs1927914 polymorphism was associated with susceptibility to ischemic stroke in males. Moreover, the rs10759932 polymorphism may affect inflammatory response in ischemic stroke patients. PMID: 29075930 There was no difference found in MMP-2, MMP-9 or TLR-4 levels between non-thrombocytopenic and thrombocytopenic septic donors. PLA formation was increased in thrombocytopenic patients. PMID: 29734352 there was a negative correlation between YKL-40 and TLR4 expression in chronic sinusitis patients with nasal polyps. YKL-40 and TLR4 interacted with each other to activate NF-kappaB and promote disease progression. PMID: 29921378 High expression of MMP-9 and TLR4 in patients with COPD may promote inflammatory cell infiltration, induce proliferation of smooth muscle cells, degrade extracellular matrix, and play an important role in lung revascularization. PMID: 28537664 our findings confirm that in south Tunisian patients with IBD, the TLR4-Thr399Ile variant is strongly associated with susceptibility to CD and that the two polymorphisms of this receptor (TLR4-Thr399Ile and TLR4-Asp299Gly) may play a role in the clinical expression of UC. PMID: 29055077 Logistic analysis showed that both rs11536889 and rs7873784 in TLR4 were associated with risk of type-2 diabetes mellitus (T2DM) complicated by tuberculosis (TB) (T2DMTB) in additive and dominant models. Carriers with homozygous and heterozygous mutants of rs11536889 and rs7873784 were associated with higher T2DMTB risk than those with wild-type homozygotes PMID: 29073942 Involvement of the TLR-4 in the mediation of the biglycan action was confirmed using a specific silent agent (siRNA). Taken together, these data could be used to develop new anti-inflammatory approaches PMID: 29339093 TLR4 was significantly up-regulated in synovial tissue samples from rheumatoid arthritis patients. PMID: 28987944 The results revealed a lack of association for TLR4 variant with ischemic stroke and hemorrhagic stroke, although a significant association was observed with the subtypes extracranial large artery. PMID: 28963650 TREM-2 promotes acquired cholesteatoma-induced bone destruction by modulating TLR4 signaling pathway and osteoclasts activation PMID: 27934908

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.