Recombinant Human Toll-Like Receptor 1 (TLR1) Protein (His)

Name: Recombinant Human Toll-Like Receptor 1 (TLR1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10458P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Toll-Like Receptor 1 (TLR1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q15399
Target Symbol	TLR1
Synonyms	CD281; CD281 antigen; KIAA0012; LPRS5; rsc786; TIL; TIL. LPRS5; Tlr1; TLR1_HUMAN; Toll (Drosophila) homolog; Toll like receptor 1; Toll-like receptor 1; Toll/interleukin-1 receptor-like protein
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNIT
Expression Range	25-580aa
Protein Length	Partial
Mol. Weight	65.2kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Participates in the innate immune response to microbial agents. Specifically recognizes diacylated and triacylated lipopeptides. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Forms the activation cluster TLR2:TLR1:CD14 in response to triacylated lipopeptides, this cluster triggers signaling from the cell surface and subsequently is targeted to the Golgi in a lipid-raft dependent pathway. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cytoplasmic vesicle, phagosome membrane; Single-pass type I membrane protein. Membrane raft. Golgi apparatus.
Protein Families	Toll-like receptor family
Database References	HGNC: 11847 OMIM: 601194 KEGG: hsa:7096 STRING: 9606.ENSP00000354932 UniGene: PMID: 29175392 rs5743618 polymorphism increased the the risk of needing inhaled corticosteroids at 11-13 years of age for postbronchiolitis asthma PMID: 28692144 Suggest that the TLR1 rs4833095 polymorphism may play a role in the development and progression of IgA nephropathy in a Chinese Han population. PMID: 27806314 genetic polymorphism is associated with transplant-related mortality in hematologic malignancies PMID: 27369862 Significant correlations with atherosclerosis susceptibility were found for the toll like receptor 1 (TLR1) rs5743551 polymorphism and toll like receptor 6 (TLR6) rs5743810 polymorphism. PMID: 28474755 Study concludes that genetic variation in the TLR10-TLR1-TLR6 gene cluster mediates responsiveness to organic dust, but indicates different signaling pathways for IL-6 and TNF-alpha. These studies provide new insight into the role of the TLR10-TLR1-TLR6 gene cluster and the innate immune response to organic dust. PMID: 28123183 data indicates that different TLR genes may actually play a role in the IL-17 production. In addition, different markers of TLR1, 2 and 4 appeared associated with serum levels of other important cytokines and chemokines that take part in the leprosy pathogenesis PMID: 28327786 Association analyses yielded a significant result for the TLR1 variant rs3923647, conferring strong protection against Tuberculosis (Odds ratio [OR] 0.21, CI confidence interval [CI] 0.05-0.6, Pnominal 1 x 10-3) when applying a recessive model of inheritance. PMID: 27214039 Our data suggest that TLR1 rs5743618 could serve as a predictor of clinical response to FOLFIRI plus bevacizumab in patients with mCRC. PMID: 27196764 rs5743551 and rs5743618 polymorphisms affected the risk of pulmonary tuberculosis in an Iranian population PMID: 27998389 Studied the relationship between polymorphisms in MBL, TLR1, TLR2 and TLR6 encoding genes and stimulated IFN-gamma and IL-12 ex vivo production in BCG osteitis survivors. Found that variant genotypes of the MBL2 gene (if homozygous) and variant genotypes of the TLR2 gene (only heterozygotes present) are associated with low IFN-gamma production. PMID: 27755461 2 single nucleotide polymorphisms in toll like receptor 1 were significantly associated with Treponema denticola. PMID: 27727278 We found lower expression levels of TLR1, TLR3, TLR4, TLR7 and TLR9 in PBMCs from patients with ALL compared with those from control patients. We also observed that the PBMCs from patients with Pre-B and B ALL had lower TLR4 expression than controls PMID: 27277333 These data suggest that the TLR1 N248S polymorphism might play a role in Th1/Th2 differentiation, and the determination of serum IgE levels. PMID: 25825356 a case-control study of 504 Papua New Guinean children with severe malaria showed that a genetic variant in TLR1 may contribute to the low severe malaria case fatality rates in this region through a reduced pro-inflammatory cellular phenotype. PMID: 26633000 The data suggest that genetic variation in TLR1 has effects on the host response to Plasmodium falciparum malaria in Asian populations. PMID: 26738805 a novel mechanism of action for TLR1 SNP rs5743618 in modulating polymorphonuclear leukocytes priming responses. PMID: 26729809 concluded that TLR-1 rs4833095 and TLR10 rs10004195 confer susceptibility to development of gastroduodenal disease, especially GC in H.pylori disease PMID: 26559190 SNP TLR1-248N is associated with TB protection in an Indian population and exhibits an increased immune response to Mycobacterium tuberculosis lysate in vitro. PMID: 25857934 T1805G genotype associated with reduced risk of Bacillus Calmette-Guerin osteitis following infant vaccination PMID: 25605403 The expression of TLR1 was the lowest and expression of TLR4 was the highest on leukocytes in acute otitis media children. PMID: 24629739 Toll-like receptor 1 Gene SNP rs5743618 is associated with increased risk for tuberculosis in Han Chinese children. PMID: 25544311 TLR1 rs4833095 and TLR10 rs10004195 may play crucial roles in H. pylori susceptibility and gastric pathogenesis. PMID: 25687912 Data suggest that the TLR2 Arg753Gln and TLR1 Ile602Ser SNPs influence the risk of developing leptospirosis and its severity. PMID: 25784560 Frequencies of TLR1-TLR6 two-locus haplotypes in major populations of South Urals were determined for the first time. PMID: 26470427 Polymorphisms in TLR1 (R80T), NOD2 (L1007fsX1), and MYD88 (-938C>A) are associated with predisposition to development of chronic Q fever. PMID: 25722298 Expression of toll-like receptors 1-5 but not TLR 6-10 is elevated in livers of patients with non-alcoholic fatty liver disease. PMID: 24351080 rs4833095 of TLR1 may be associated with the susceptibility for alopecia areata in the Korean population PMID: 24780078 Genetic variation rs5743565 in TLR1 might be associated with the decreased susceptibility to Graves disease, whlie polymorphisms in TLR6 and TLR10 did not reach the statistical significance. PMID: 25028161 These results clarify the importance of TLR2/1 and FcgammaRII in platelet adhesion and activation, and strengthen the role of platelets as an active player in sensing bacterial infections. PMID: 25553878 The correlation between TLR1, TLR6, and TLR10 polymorphisms and the development of atopic dermatitis in the Republic of Bashkortostan has been found. PMID: 25850295 SNPs in the exons of TLR1 and TLR6 are associated with susceptibility to type 1 diabetes in the Chinese population. PMID: 25261617 Data show that a total of nine single-nucleotide polymorphisms (SNPs) in TLR1, TLR4, TLR6 and TLR8 in Caucasians, and two other SNPs, one each in Toll-like receptors TLR4 and TLR8, in African Americans were significantly associated with HIV status. PMID: 25253287 T1805G polymorphism not associated with severity of bronchiolitis or risk of postbronchiolitis wheezing PMID: 24112285 No association was observed for either TLR1 1805 T>G or TLR6 745 C>T polymorphism and pulmonary tuberculosis. PMID: 24984237 A common TLR1 polymorphism (T-->G mutation at position 1805) is associated with an increased risk of laboratory-defined neurosyphilis PMID: 24922103 TLR1 polymorphisms could influence immune-related disease through Teff resistance to Treg suppression. PMID: 25378593 This review summarizes current knowledge of the multiple roles of toll-like receptors in bacterial lung infections and highlights the mechanisms used by pathogens to modulate or interfere with TLR signaling in the lungs. PMID: 25033332 TLR2 and its co-receptors, TLR1 and TLR6, contribute to the pathogenicity of aPLA; aPLA are internalized via clathrin- and CD14-dependent endocytosis; and endocytosis is required for NF-kappaB activation PMID: 24612386 Authors demonstrated that TLR1 rs5743618 was associated with asthma and atopic eczema during the first 6 years of life after early bronchiolitis and TLR6 rs5743810 was associated with present atopy at preschool age. PMID: 24445834 TLR1 expression in periprosthetic tissues most accurately predicted periprosthetic joint infection. PMID: 25320195 the genetic architecture of TLR1 variation differs substantially in southeast Asians compared to other populations and common variation in TLR1 in Thais is not associated with outcome from melioidosis. PMID: 24392083 Data indicate that single nucleotide polymorphism of toll-like receptor TLR1 was significantly associated with a reduced risk of coronary artery disease (CAD). PMID: 25128583 Four genes showed increased expression in the epithelium of OLP patients: CD14, CXCL1, IL8, and TLR1, and at least two of these proteins, TLR1 and CXCL1, were expressed at substantial levels in oral keratinocytes. PMID: 24581860 Interestingly, 602Ser, which shows signatures of selection, inhibits TLR1 surface trafficking and subsequent activation of NFkappaB upon recognition of a ligand. This suggests that reduced TLR1 activity may be beneficial for human health. PMID: 24002163 Toll like receptor 1 single nucleotide polymorphism I602S may play a role in the pathogenesis of M. abscessus lung infection in patients with cystic fibrosis. PMID: 23403223 Triggering the TLR2/1 complex with Pam3CSK4 initiates human platelet activation by engaging tyrosine kinases of the src family and Syk, the adaptor protein LAT, as well as the key mediator PLCgamma2. PMID: 24240055 In the genetic association analysis, polymorphisms in TLR1 (S248N and R80T), TLR2 (P631H), and TLR6 (P249S) were associated with an increased susceptibility to complicated skin and skin structure infections. PMID: 24511099 These results suggest that TLR2/1 signaling and S1P cooperate in pro-inflammatory cytokine production and myofibroblast differentiation and promote cell migration of skin fibroblast PMID: 24440818 Genetic variation in TLR1 is associated with increased mortality in patients with sepsis after traumatic injury. PMID: 23478521

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Toll-Like Receptor 1 (TLR1) Protein (His)

Recombinant Human Toll-Like Receptor 1 (TLR1) Protein (His)

Product Overview

Target Details

FAQs