Recombinant Human Thymosin Beta-10 (TMSB10) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-01963P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Thymosin Beta-10 (TMSB10) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-01963P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Thymosin Beta-10 (TMSB10) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P63313
Target Symbol TMSB10
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Expression Range 2-44aa
Protein Length Full Length of Mature Protein
Mol. Weight 31.6 kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Subcellular Location Cytoplasm, cytoskeleton.
Protein Families Thymosin beta family
Database References

HGNC: 11879

OMIM: 188399

KEGG: hsa:9168

STRING: 9606.ENSP00000233143

UniGene: PMID: 28179017

  • High expression of thymosin beta 10 is associated with hepatocellular carcinoma. PMID: 25037578
  • High expression levels of TMSB10 correlated with lymphatic metasttases in papillary thyroid carcinoma, especially in the central neck region. PMID: 24974154
  • Regarding HCC, Tbeta4 reactivity was detected in 7/23 cases (30%) and Tbeta10 reactivity in 22/23 (97%) cases analyzed, adding HCC to human cancers that express these beta-thymosins. PMID: 24704991
  • Low expression of Tbeta10 is associated with metastatic phenotype of CCA in vitro and in vivo. PMID: 24053380
  • The results show, for the first time, a strong expression of thymosin beta 10 in the human salivary glands during the initial phases of the physiological development, present at the 13th week of gestation, and suggesting a role for the peptide in the salivary glands' organogenesis. PMID: 21733645
  • Thymosin beta10 expression driven by the human TERT promoter induces ovarian cancer-specific apoptosis through ROS production. PMID: 22623951
  • Amplification of thymosin beta 10 is associated with metastatic and aggressive papillary thyroid carcinomas. PMID: 22161024
  • hypomethylation of the promoter is not associated with its overexpression in non-small cell lung cancer PMID: 22038593
  • Describe beta-thymosins in bronchoalveolar lavage fluid and their possible involvement in the pathogenesis of scleroderma lung disease. PMID: 21314931
  • The expression of Tbeta10 in the human kidney during the initial phases of its physiological development, mainly restricted in the proximal and the distal tubuli. PMID: 20836742
  • TB10 plays a critical role in the regulation of anchorage-independent growth and assembly of actin filaments. PMID: 12481941
  • Introduction of E-Tmod cDNA into a tumor cell line reverses TB10 mediated apoptosis and restored actin architectures. PMID: 14741341
  • TB10 has a role in progression of human thyroid carcinomas, particularly in the anaplastic histotypes PMID: 15254683
  • Inhibition of Ras signal transduction by thymosin beta(10) results in antiangiogenic and antitumor effects, suggesting that thymosin beta(10) may be valuable in anticancer therapy. PMID: 15665289
  • results strongly suggest that Thr20 is specifically required for actin sequestration by TB10 in ovarian cancer cells PMID: 16012174
  • the distribution of staining for thymosin beta10 was inverse of staining for F-actin. These data support a physiological role for thymosin beta10 in sequestration of G-actin as well as in cancer cell motility. PMID: 16786322
  • Expression of TB10 and its role in non-small cell lung cancer are reported. PMID: 18789485
  • Thymosin beta-10 is aberrantly expressed in pancreatic cancer and induces JNK activation. PMID: 19194824
  • outlines for the first time that salivary glands during foetal life express and secrete peptides such as beta-thymosins probably involved in the development of the oral cavity and its annexes PMID: 19337364
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed