Recombinant Human Thrombopoietin (THPO) Protein (His&His), Active

Beta LifeScience SKU/CAT #: BLC-05936P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Human Thrombopoietin (THPO) Protein (His&His), Active

Beta LifeScience SKU/CAT #: BLC-05936P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Thrombopoietin (THPO) Protein (His&His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is less than 10 ng/ml.
Uniprotkb P40225
Target Symbol THPO
Synonyms C mpl ligand; C-mpl ligand; Megakaryocyte colony stimulating factor; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Megakaryocyte stimulating factor; MGC163194; MGDF; MKCSF ; ML; MPL ligand; MPLLG; Myeloproliferative leukemia virus oncogene ligand; Prepro thrombopoietin; THCYT1; THPO; Thrombopoietin; Thrombopoietin nirs variant 1; TPO; TPO_HUMAN
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag N-6His&C-6His
Complete Sequence SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Expression Range 22-353aa
Protein Length Full Length of Mature Protein
Mol. Weight 37.3 kDa
Research Area Cancer
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Subcellular Location Secreted.
Protein Families EPO/TPO family
Database References

HGNC: 11795

OMIM: 187950

KEGG: hsa:7066

STRING: 9606.ENSP00000204615

UniGene: PMID: 29313460

  • FISH study showed no cytogenetic abnormalities in any of the analyzed cases. PMID: 16682284
  • results confirm that TPO acts as an acute phase protein but exclude the possibility that it is uniquely responsible for thrombocytosis of inflammatory disorders, which might recognize in IL-6 a credible candidate as a cooperating factor. PMID: 18041648
  • evidence for the presence of a low TPO gene expression transcript in B-CLL cells; early B-cell CLL circulating level of TPO does not provide a useful insight into the complex interrelationship of prognostic variables PMID: 18203013
  • Thrombopoietin levels are increased in patients with severe acute respiratory syndrome; TPO may have a role in thrombocytosis, which frequently develops from thrombocytopenia in SARS patients PMID: 18314161
  • separate binding sites on the Mpl receptor for TPO and hNUDC identified PMID: 20529857
  • Tensin2 is an important new mediator in TPO/c-Mpl pathway; Tensin2 becomes phosphorylated in a TPO dependent manner. PMID: 21527831
  • perioperative TPO dynamics are associated with postoperative LD. Postoperative TPO levels were found to be lowest in high-risk patients (HCC patients undergoing major resection) but showed an independent predictive value. PMID: 25611592
  • Data indicate thrombopoietin (TPO) as potential early prognostic biomarker in acute pancreatitis (AP) patients. PMID: 28079612
  • These studies demonstrate that biallelic loss-of-function mutations in THPO cause bone marrow failure, which is unresponsive to transplant due to a hematopoietic cell-extrinsic mechanism. PMID: 28559357
  • Genetically engineered mesenchymal stromal cells produce IL-3 and TPO to further improve human scaffold-based xenograft models PMID: 28456746
  • High Thrombopoietin expression is associated with immune thrombocytopenia in pregnancy. PMID: 26840092
  • Colorectal cancer tumor-initiating cells (TICs) expressing CD110, the thrombopoietin (TPO)-binding receptor, mediate liver metastasis. We show that TPO promotes metastasis of CD110+ TICs to the liver by activating lysine degradation. PMID: 26140605
  • decreased TPO levels or decreased bone marrow production of platelets may not be a cause of thrombocytopenia in chronic hepatitis C PMID: 25728497
  • WASP, RUNX1, and ANKRD26 genes are important for normal TPO signaling and the network underlying thrombopoiesis. PMID: 26175287
  • Data suggest that elevated serum level of thrombopoietin may serve as unfavorable marker of stage of multiple myeloma. PMID: 25323752
  • The regulation of OCs by TPO highlights a novel therapeutic target for bone loss diseases and may be important to consider in the numerous hematologic disorders associated with alterations in TPO/c-mpl signaling PMID: 25656774
  • TPO was greatly enhanced in HPT in comparison with ITP patients (958 +/- 659 and 11 +/- 27 pg/ml, p < 0.001). In the ITP group a reverse correlation was detected between TPO and glycocalicin (r = -0.373, p = 0.006). PMID: 25472766
  • observations suggest that NRP-1 is involved in megakaryocytopoiesis through complex formation with PDGFRs, and that NRP-1-PDGFR-complexes may contribute to effective cellular functions mediated by TPO and PDGF in megakaryocytic cells PMID: 25744030
  • An Arg->Cys substitution at residue 38 or residue 17 excluding the 21-AA signal peptide of the receptor binding domain was found in a family with aplastic anemia. Adding a 5th cysteine may disrupt normal disulfide bonding & receptor binding. PMID: 24085763
  • increased plasma thrombopoietin levels were associated with a favorable prognosis of bone marrow failure and could, therefore, represent a reliable marker for a benign subset of myelodysplastic syndrome. PMID: 23403320
  • Increased TPO levels may increase both platelet count and platelet size, resulting in more hemostatic tendency, which may contribute to the progression of ischemic stroke. PMID: 22327824
  • Platelet count and serum thrombopoietin level as predictors for morbidity and/or mortality in thrombocytopenic neonates. PMID: 22980223
  • Data indicate increased levels of serum thrombopoietin (TPO) were found in necrotizing pancreatitis. PMID: 22698803
  • Mutation in the THPO gene is not associated with aplastic anaemia in Japanese children. PMID: 22686250
  • Thrombopoietin is a biomarker and mediator of cardiovascular damage in critical diseases [review] PMID: 22577249
  • Findings establish that Clock regulates Thpo and Mpl expression in vivo, and demonstrate an important link between the body's circadian timing mechanisms and megakaryopoiesis. PMID: 22284746
  • Overstimulation of the THPO pathway might therefore predispose to clonal hematopoietic disease and to congenital abnormalities. PMID: 22453305
  • Data show that serum thrombopoietin levels in the affected family members were significantly higher than in the non-affected family members or healthy controls. PMID: 22194398
  • pattern of megakaryocytopoiesis is associated with up-regulated thrombopoietin (TPO) signaling through mammalian target of rapamycin (mTOR) and elevated levels of full-length GATA-1 and its targets PMID: 21304100
  • Human thrombopoietin knockin mice efficiently support human hematopoiesis in vivo. PMID: 21262827
  • Findings thus suggest that decreased thrombopoietin production accompanying liver dysfunction may be related to thrombocytopenia besides myelosuppression in anorexia nervosa with malnutrition. PMID: 19810087
  • TPO negatively modulates cardiac inotropy in vitro and contributes to the myocardial depressing activity of septic shock serum PMID: 20467749
  • Overexpreeeion of human thrombopoietin increased the platelet level in the transfected mice. PMID: 11877062
  • Mutations in the 5' untranslated region of the TPO gene are not the cause of the normal or elevated TPO levels in acquired essential thrombocythemia. PMID: 11860444
  • REVIEW: central role in the pathogenesis of idiopathic thrombocytopenic purpura (ITP), andother immune-mediated thrombocytopenias. PMID: 11913997
  • While there is increased platelet turnover in patients with chronic renal failure, the kidney does not seem to play a major role in the overall Tpo production in the body. PMID: 11960394
  • binding to platelet thrombopoietin receptor is directly involved in human thrombopoietin plasma level regulation PMID: 11961237
  • Flt3/Flk-2-ligand in synergy with thrombopoietin may slow down megakaryocyte development by causing increased proliferation of megakaryocyte progenitor cells. PMID: 11983110
  • In the presence of EPO and SCF and/or IL-3, TPO enhances bone marrow erythropoiesis in cell cultures derived from patients with Diamond-Blackfan anemia. PMID: 12041668
  • Thrombopoietin activates MAPKp42/44, AKT, and STAT proteins in normal human CD34+ cells, megakaryocytes, and platelets. PMID: 12135673
  • The endogenous levels of TPO, IL-6 and IL-8 are elevated in the thrombocytopenic patients with AML and MDS. PMID: 12187073
  • induces megakaryocyte-specific glycoprotein VI promoter and its regulation by GATA-1, Fli-1, and Sp1 PMID: 12359731
  • no difference was found in the cord blood level of thrombopoietin between infants born to mothers with pregnancy-induced hypertension and those without PMID: 12381927
  • review of TPO role in thrombopoiesis, signal transduction, cellular proliferative and anti-apoptotic mechanisms increasing megakaryocyte numbers PMID: 12430879
  • levels in children with acute and chronic idiopathic thrombocytopenic purpura and its relationship with mega-dose methylprednisolone therapy PMID: 12468916
  • Tpo concentrations in plasma samples taken concurrently from the right ventricle, the pulmonary artery, and the left ventricle showed there were positive correlations between the Tpo levels and pulmonary artery systolic pressure. PMID: 12487786
  • TPO stimulation of a megakaryocyte cell line activated lyn kinase, shown to be involved in the transduction pathway of the TPO proliferative signal. PMID: 12495897
  • Production of this protein in human hepatic cell cultures is not affected by IFN-alpha, IFN-beta, and IFN-gamma. PMID: 12581491
  • c-mpl mutations are the cause not only for the hypomegakaryocytic thrombocytopenia, but also for the development of an aplastic anemia (AA) in patients with CAMT PMID: 12799278
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed