Recombinant Human Thioredoxin Domain-Containing Protein 12 (TXNDC12) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10150P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Thioredoxin Domain-Containing Protein 12 (TXNDC12) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10150P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Thioredoxin Domain-Containing Protein 12 (TXNDC12) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O95881 |
| Target Symbol | TXNDC12 |
| Synonyms | AG1; AGR1; anterior gradient homolog 1; endoplasmic reticulum protein ERp19; Endoplasmic reticulum resident protein 18; Endoplasmic reticulum resident protein 19; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; ER protein 18; ER protein 19; ERP 18; ERP16; ERp18; ERp19; hAG 1; hAG1; hTLP19; PDIA16; protein disulfide isomerase family A, member 16; thioredoxin domain containing 12 (endoplasmic reticulum; Thioredoxin domain-containing protein 12; thioredoxin like protein p19; Thioredoxin-like protein p19; TLP19; TXD12_HUMAN; TXNDC12 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL |
| Expression Range | 27-172aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 32.4kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Possesses significant protein thiol-disulfide oxidase activity. |
| Subcellular Location | Endoplasmic reticulum lumen. |
| Database References | HGNC: 24626 OMIM: 609448 KEGG: hsa:51060 STRING: 9606.ENSP00000360688 UniGene: PMID: 25940440 |
