Recombinant Human Tgfb1-Induced Anti-Apoptotic Factor 1 (TIAF1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09111P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tgfb1-Induced Anti-Apoptotic Factor 1 (TIAF1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09111P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tgfb1-Induced Anti-Apoptotic Factor 1 (TIAF1) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O95411 |
| Target Symbol | TIAF1 |
| Synonyms | TIAF1; TGFB1-induced anti-apoptotic factor 1; 12 kDa TGF-beta-1-induced antiapoptotic factor |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG |
| Expression Range | 1-115aa |
| Protein Length | Full Length |
| Mol. Weight | 39.4kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation. |
| Subcellular Location | Nucleus. |
| Database References | HGNC: 11803 OMIM: 609517 KEGG: hsa:9220 STRING: 9606.ENSP00000352424 UniGene: PMID: 22534828 |
