Recombinant Human Tgf-Beta Receptor Type-2 (TGFBR2) Protein (His&Myc)

Name: Recombinant Human Tgf-Beta Receptor Type-2 (TGFBR2) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00213P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tgf-Beta Receptor Type-2 (TGFBR2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P37173
Target Symbol	TGFBR2
Synonyms	(TGFR-2)(TGF-beta type II receptor)(Transforming growth factor-beta receptor type II)(TGF-beta receptor type II)(TbetaR-II)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ
Expression Range	23-166aa
Protein Length	Partial
Mol. Weight	23.8 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Membrane raft.
Protein Families	Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Database References	HGNC: 11773 OMIM: 133239 KEGG: hsa:7048 STRING: 9606.ENSP00000351905 UniGene: PMID: 28443643 TGFBR2 Polymorphisms Are Associated with Colorectal Cancer in Patients with Lynch Syndrome. PMID: 30275229 This study has confirmed or corrected the clinical diagnosis, and enlarged the mutation spectrum of FBN1 and TGFBR2 and confirmed that parental mosaicism may be the cause of the varied phenotypic expression of these connective tissue disorders.The results should be helpful for prenatal diagnosis and genetic counseling. PMID: 30101859 the restoration of TGFBR2 in miR-204 overexpression Gastric cancer (GC) cells, which recovered resistance to 5-FU treatments compared with miR-204 overexpression GC cells. PMID: 29940566 MiR-9-5p promotes the proliferation, metastasis and invasion of non-small cell lung cancer cells by down-regulating TGFBR2 expression. PMID: 29239816 Microarray-based analyses revealed that the expression of miR-20b was significantly increased, whereas TGFBR2 and MYC were significantly downregulated and upregulated, respectively, in all ES cells compared to their expression in human mesenchymal stem cells (hMSCs). PMID: 29039480 this study provides evidence that TGFBR2 rs6785358 polymorphism might be associated with the risk of hypospadias. PMID: 28894026 Down-regulation of TGF-beta RII was found in the invasive non-functioning pituitary adenomas compared to noninvasive ones. PMID: 29031543 findings reveal a novel role for miR-204/ANGPT1/TGFbetaR2 axis in tumor angiogenesis. We propose that therapeutic manipulation of miR-204 levels may represent a promising approach in breast cancer. PMID: 27703260 High TGFBR2 expression is associated with small cell lung cancer. PMID: 28055980 expression induced by IL-6 in keratinocytes PMID: 27892604 hsa-miR-1193 may be involved in sporadic colorectal cancer tumourigenesis at least in part by suppression of TGFBR2, and the A allele of rs11466537 disturbed the regulation of hsa-miR-1193 on TGFBR2. PMID: 28494187 Results show that TGFbR2 expression decreases in human gastric cancer (GC) tissue specimens and indicate that the expression of TGFbR2 is mainly dependent on post-transcriptional regulators in GC through miR-155 binding to the 3'-UTR of its mRNA. PMID: 29247570 This study demonstrated that Increased Transforming Growth Factor beta2 in the Neocortex of Alzheimer's Disease and Dementia with Lewy Bodies is Correlated with Disease Severity and Soluble Abeta42 Load. PMID: 27911312 Data indicate the most significant gene level association seen with transforming growth factor beta receptor 2 (TGFBR2) and clear cell epithelial ovarian cancer (EOC). PMID: 27533245 Abnormal expression of TGF-beta type II receptor isoforms contributes to prognosis in acute myeloid leukemia. PMID: 28052022 altered Tgfbeta signaling in cultured mouse and human enteroids supports further the in vivo data and reveals a critical role for Tgfbeta signaling in generating precursor secretory cells. Overall, our data reveal a key role for Tgfbeta signaling in regulating ISCs clonal dynamics and differentiation, with implications for cancer, tissue regeneration, and inflammation. PMID: 27791005 MiR-130 is up-regulated in gastric cancer (GC) tissues and directly targets TGF-beta type II receptor (TGFbetaR2). PMID: 27304191 miR-17-5p negatively regulated TGFBR2 expression by directly binding to the 3'UTR of TGFBR2 mRNA, thereby promoting gastric cancer cell growth and migration. PMID: 27120811 High TGFBR2 expression is associated with mesenchymal to epithelial transition of breast cancer. PMID: 28987542 Inhibition of TGFBR2 had the similar effect as miR-9 overexpression. PMID: 27756824 we describe and characterize the functional impact of a novel VUS in the TGFBR2 kinase domain (c.1255G>T; p.Val419Leu), in a patient with the clinical diagnosis of Marfan syndrome spectrum. Our results establish that the V419L variant leads to aberrant TGF-beta signaling and confirm the diagnosis of Loeys-Dietz syndrome in this patient. PMID: 28679693 Apo and inhibitor-bound TGFBR2 kinase structures are presented at high resolution (<2 A). PMID: 27139629 TGF-beta type I, II, and III receptors were all identified in pregnant serum; all were substantially elevated in early-onset but not late-onset PE. Endoglin was increased in both subtypes. PMID: 28633389 this is the first clinical report to demonstrate a potential causal association between TGFB2 gene mutations and aortic root dilatation in combination with the myxomatous degeneration of both atrioventricular valves. PMID: 28633253 Molecular modeling and molecular dynamic simulation of the effects of variants in the TGFBR2 kinase domain as a paradigm for interpretation of variants obtained by next generation sequencing. PMID: 28182693 A novel mutation in the TGFBR2 gene was identified in a patient with Loeys-Dietz syndrome. PMID: 28344185 ZNF32 was found to directly bind to the TGF-betaR2 (transforming growth factor-beta receptor 2) promoter to promote its expression. PMID: 27763636 High TGFBR2 expression is associated with glioma. PMID: 28184932 these findings delineate the important function of the TGFbeta signaling pathway in the early development of kidney and TbetaRII was shown to be able to promote the expression of Six2 through Smad3 mediating transcriptional regulation and in turn activate the proliferation of MM cells. PMID: 28420207 YAP-1 promotes Tregs differentiation in hepatocellular carcinoma by enhancing TGFBR2 transcription. PMID: 28472799 Gasdermin C is upregulated by inactivation of Tgfbr2 in the presence of mutated Apc, promoting colorectal cancer cell proliferation. PMID: 27835699 Depending on the TGFBR2 expression status of their donor cells, shed exosomes show distinct proteomic signatures and promote altered cytokine secretion profiles in recipient cells. PMID: 28376875 miR-520f inhibited tumor cell invasion by directly targeting ADAM9 and the TGFbeta receptor TGFBR2. PMID: 28209612 Study demonstrated that the TGFBR2 mutation was not present in the sample of cervico-cerebral artery dissection patients (CCAD); however, a positive association was identified between the MTHFR-C677T polymorphism and genetically confirmed Mexican mestizo spontaneous CCAD patients PMID: 27017342 A genetic investigation found a TGFbetaR2 gene mutation, leading to the diagnosis of Loeys-Dietz syndrome type2. PMID: 27017362 The results showed that transfection of CD34(+) cells with SiRNA targeting TGF-bRII and their co-culture with human bone marrow mesenchymal stromal cells (MSCs) could considerably increase the number of progenitors PMID: 27344285 Cell invasion (matrigel) was reduced only in the Hs578T cells (p < 0.01). Silencing decreased the expression of the prometastatic molecules S100A4 and TGFbetaR2 in both cell lines and CD44 in Hs578T cells. We conclude that ECM1 is a key player in the metastatic process and regulates the actin cytoskeletal architecture of aggressive breast cancer cells at least in part via alterations in S100A4 and Rho A. PMID: 27770373 Our study uncovers a novel mechanism that miR-19a-3p/19b-3p inhibits autophagy-mediated fibrogenesis by targeting TGF-beta R II. PMID: 27098600 TGFBR2 signaling can affect Notch1 glycosylation via regulation of glycosyltransferase LFNG expression and provide a first mechanistic example for altered glycosylation in microsatellite instability colorectal tumor cells. PMID: 27156840 CD44 and TGFBR2 are the functional targets of miR-373, which are responsible for the tumor suppressive functions of miR-373 PMID: 26858153 Polymorphism of TGFBR2 is associated with coronary artery disease. PMID: 27234600 Results found TGFBR2 to be significantly related to the regulated phosphoproteome in glioblastoma as a result of integrative upstream kinase/ regulator analyses and experimentally validated as a novel regulator of glioblastoma stem cells. PMID: 26670566 Reduced expression of TGF-beta type II receptor and extracellular matrix components in response to reduced fibroblast size/mechanical force was fully reversed by restoring size/mechanical force PMID: 26780887 results suggested that high CDKN1A/p21 and low TGFBR2 expression was closely correlated with adverse pathological parameters and poor prognosis in breast cancer. PMID: 26823785 Findings suggest that the upregulation of miR-590-5p promotes cellular malignant behavior via the target gene TGFbetaRII in vulvar squamous cell carcinoma. PMID: 26498065 TGFBR2 is regulated by an epigenetic auto-feedback regulation in non-small cell lung cancer. PMID: 26356817 we reported a sporadic Japanese case of LDS with a novel TGFBR2 p.Y424H mutation, which appeared to cause pregnancy-related fatal aortic/arterial dissections. PMID: 26301661 AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells PMID: 26867007 High levels of TbetaRII expression were associated with lymph node metastasis, increasing tumor clinical stage, and poorer 5-year disease-free survival in patients with breast cancer. TbetaRII may be a potential prognostic marker for breast cancer. PMID: 26551005

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.