Recombinant Human Tetraspanin-7 (TSPAN7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04183P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tetraspanin-7 (TSPAN7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04183P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tetraspanin-7 (TSPAN7) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P41732 |
| Target Symbol | TSPAN7 |
| Synonyms | A15; CCG B7; CD231; CD231 antigen; Cell surface glycoprotein A15; DXS1692E; Membrane component chromosome X surface marker 1; Membrane component X chromosome surface marker 1; MRX58; MXS1; T cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; TALLA 1; TALLA; TALLA-1; TALLA1; Tetraspanin 7; Tetraspanin-7; TM4SF2; TM4SF2b; Transmembrane 4 superfamily 2b; Transmembrane 4 superfamily member 2; Transmembrane protein A15; TSN7_HUMAN; Tspan 7; Tspan-7; TSPAN7 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | RHEIKDTFLRTYTDTMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM |
| Expression Range | 113-213aa |
| Protein Length | Partial |
| Mol. Weight | 14.5kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May be involved in cell proliferation and cell motility. |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
| Protein Families | Tetraspanin (TM4SF) family |
| Database References | HGNC: 11854 OMIM: 300096 KEGG: hsa:7102 STRING: 9606.ENSP00000367743 UniGene: PMID: 28223337 |
