Recombinant Human Tetraspanin-2 (TSPAN2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11074P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tetraspanin-2 (TSPAN2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11074P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tetraspanin-2 (TSPAN2) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O60636 |
| Target Symbol | TSPAN2 |
| Synonyms | TSPAN2; Tetraspanin-2; Tspan-2; Tetraspan NET-3 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | C-6His |
| Target Protein Sequence | GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL |
| Expression Range | 112-188aa |
| Protein Length | Partial |
| Mol. Weight | 9.5 |
| Research Area | Stem Cells |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
| Protein Families | Tetraspanin (TM4SF) family |
| Database References | HGNC: 20659 OMIM: 613133 KEGG: hsa:10100 STRING: 9606.ENSP00000358529 UniGene: PMID: 29198723 |
