Recombinant Human Testisin (PRSS21) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08634P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Testisin (PRSS21) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08634P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Testisin (PRSS21) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9Y6M0 |
Target Symbol | PRSS21 |
Synonyms | Eosinophil serine protease 1; ESP-1; ESP1 ; Prss21; Serine protease 21; TEST_HUMAN; TEST1; Testisin |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS |
Expression Range | 42-288aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 31.8kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Could regulate proteolytic events associated with testicular germ cell maturation. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Protein Families | Peptidase S1 family |
Database References | |
Tissue Specificity | Expressed predominantly in premeiotic testicular germ cells, mostly late pachytene and diplotene spermatocytes. |
Gene Functions References
- Testisin activates PAR-2, inducing PAR-2 loss from the cell surface, internalization, and cellular signaling. PMID: 25519908
- Testisin may promote carcinogenesis by inhibiting tumor suppressor activity of maspin. PMID: 20211623
- Loss of Testisin is caused, at least in part, by DNA hypermethylation and histone deacetylation, and suggest a tumour suppressor role for Testisin in testicular tumorigenesis. PMID: 15685234
- The results demonstrate for the first time that aberrant methylation of specific CpG sites near the transcription initiation site is an important factor in testisin gene silencing in TGCT. PMID: 16810501
- These data suggest that aberrant regulation of PRSS21 may underlie certain secondary male infertility syndromes, such as "easily decapitated" spermatozoa in humans. PMID: 19571264