Recombinant Human Tenascin (TNC) Protein (His)

Name: Recombinant Human Tenascin (TNC) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03570P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TNC.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tenascin (TNC) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P24821
Target Symbol	TNC
Synonyms	150 225; Cytotactin; Glioma associated extracellular matrix antigen; Glioma-associated-extracellular matrix antigen; GMEM; GP 150 225; GP 150-225; GP; Hexabrachion; HXB; JI; MGC167029; Miotendinous antigen; Myotendinous antigen; Neuronectin; TENA_HUMAN; Tenascin; Tenascin-C; Tenascin-C isoform 14/AD1/16; TenascinC; TN; TN C; TN-C; TNC
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Expression Range	1888-2201aa
Protein Length	Partial
Mol. Weight	39.5kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Tenascin family
Database References	HGNC: 5318 OMIM: 187380 KEGG: hsa:3371 STRING: 9606.ENSP00000265131 UniGene: PMID: 30115016 The results demonstrated that ANX2 and stromal tenascin C regulated invasion in addition to stemness and anoikis resistance, which are crucial for metastasis in the progression of pancreatic ductal adenocarcinoma. PMID: 29749431 Intratumor stromal expression of tenascin-C (TN-C) is a strong prognostic indicator in locally advanced unresectable (UR-LA) pancreatic ductal adenocarcinoma (PDAC) patients with resection after chemoradiotherapy (CRT). PMID: 29517632 this study shows that tenascin C is increased in vitiligo in lesional areas only in the acral sites PMID: 29605863 Data indicate three sites within tenascin-C that directly and cooperatively interact with toll-like receptor 4 (TLR4). PMID: 29150600 Results identify tenascin-C as an endogenous danger signal that is upregulated in systemic sclerosis and drives TLR4-dependent fibroblast activation, and by its persistence impedes fibrosis resolution. PMID: 27256716 Both fetal Tn-C variants may represent novel biomarkers that are capable of estimating both pulmonary vascular remodeling and right ventricular load. PMID: 29117120 high TNC expression correlates with worse prognosis for lung adenocarcinoma and has a role in lung cancer progressoin PMID: 28652369 Decellularized lung scaffolds treated with FBN-2 and TN-C prior to re-epithelialization supported greater epithelial proliferation and tissue remodeling. PMID: 28662401 Immunohistochemical analysis shows that the unique association between the CD44+/CD24low/- phenotype and the pronounced production of tenascin C may have a prognostic potential, prospectively indicating the inefficiency of neoadjuvant polychemotherapy (PCT), in particular that with platinum derivatives, which is used for the standard treatment of triple-negative BC. PMID: 29027523 Enhanced serum tenascin-C concentrations are closely related to trauma severity and clinical outcomes PMID: 28732652 Functional studies showed THBS1 and TNC to mediate chemoresistance through the integrin beta1/mTOR pathway. PMID: 27487140 Elevated Tenascin-C serum values are associated with non-small cell lung cancer. PMID: 26967391 Tenascin-C was abundantly secreted by the colon cancer cells with high metastatic potential, and highly expressed in lymph nodes with metastasis. PMID: 27191989 Intermittent hypoxia confers pro-metastatic gene expression selectively through NF-kappaB in inflammatory breast cancer cells, in particular, to tenascin-C and MPP9. PMID: 27717868 Metastatic prostate cancer cells cultured on osteo-mimetic surfaces coated with tenascin C exhibited enhanced adhesion and colony formation as mediated by integrin alpha9beta1. PMID: 28916657 Study showed that the proinflammatory, extracellular matrix glycoprotein tenascin-C from tissue damage and microbial lipopolysaccharide (LPS) from bacterial infection activated a common set of signaling pathways, including NF-kappaB and MAPK, but these stimuli also induced different signaling pathways downstream of TLR4. PMID: 27577261 High Tenacin C expression is associated with liver metastasis in colorectal cancer stroma. PMID: 29065427 Tenascin-C protein expression in this muscle was confined to arterioles and venules (80% of cases) and increased after training in A-allele carriers. Prior to training, volume densities of subsarcolemmal and myofibrillar mitochondria in m. vastus lateralis muscle were 49% and 18%, respectively, higher in A/A homozygotes relative to T-nucleotide carriers (A/T and T/T) PMID: 28384286 Study that recombinant TNC consisting of the epidermal growth factor (EGF-like repeats induced cerebral arterial constriction via EGF receptor and activation of ERK1/2 PMID: 27086972 Tenascin-C was abundant in cortical white and gray matter in brain tissue from Alzheimer's Disease patients. PMID: 27444354 secreted by transdifferentiated retinal pigment epithelial cells and promotes the development of choroidal neovascularization via integrin alphaV in a paracrine manner PMID: 27668890 Overexpression of TNC, SMA, and vimentin were significantly correlated with the lower overall survival in prostate cancer patients. PMID: 28341124 analysis of SNPs in tenascin-C (TNC) associated with degenerative rotator cuff tears PMID: 27248364 High TNC expression is associated with retinoblastoma. PMID: 27488116 prepartum and postpartum TN-C serum levels significantly higher in mild and severe preeclampsia than in healthy pregnancy PMID: 25567561 Tenascin-C overexpression in cancer cells and stromal fibroblasts was an independent poor prognostic factor for overall survival and disease-free survival esophageal squamous cell carcinoma patients. PMID: 26731558 Serum TNC levels are significantly raised and correlate with various clinical and laboratory variables of disease activity in children with enthesitis-related arthritis PMID: 25774061 This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway. PMID: 25646025 Co-expression of Matrix metalloproteinase-9 and Tenascin-C was associated with poorer prognosis and was found to be an independent predictor of survival PMID: 26652622 Studied the expression of TNC in tissue microarrays including 17 GBMs, 18 WHO grade III astrocytomas, 15 WHO grade II astrocytomas, 4 WHO grade I astrocytomas, and 7 normal brain tissue samples by immunohistochemical staining. PMID: 25469866 No difference in tenascin-C expression was found in COPD. PMID: 25794567 miR-133a enhances the protective capacity of cardiac progenitors cells after myocardial infarction PMID: 25448067 A pivotal role for TNC in tuning the local immune response to establish equilibrium between disseminated nodal cancer stem cells and the immune system. PMID: 25808872 lung cancer patients with Oct4 high, PTEN low and TNC high expression profile significantly correlated with poor disease-free survival PMID: 25609695 Circulating concentrations of Tn-C are higher in patients with a recent history of atherosclerotic stroke and may play an anti-inflammatory role by reducing pro-inflammatory cytokine release from atheroma. PMID: 24823872 Data indicate the expression of fetal ED-A(+) fibronectin and B (+) tenascin-C splicing variants in cardiac tissue from heart transplant recipients. PMID: 24792713 Tn-C and Gl-3 are promising markers for the diagnosis of pulmonary sarcoidosis, but they are not specific for cardiac involvement. PMID: 24777587 Subraracnoid hemorrhage, aneurysmal that is more severe induces more TNC, which may cause the subsequent development of both vasospasm and vasospasm-unrelated secondary brain injury, leading to ischemia. PMID: 25366610 The coated combination of TnC and TnR appeared to regulate neural differentiation signaling through integrin alpha7 and alpha9beta1 in bone marrow-derived human mesenchymal stem cells. PMID: 24829055 the fibronectin type III-like repeats in tenascin-C may be playing an important role in PCO. PMID: 25515583 Results found that Tenascin-C FNIIIA1 is over-expressed in osteosarcoma tissues and can promote MG-63 cell migration suggesting that high expression of A1 may promote metastasis of osteosarcoma. PMID: 24598996 Demonstrate that tenascin-C level is associated with pathologic conditions in acute coronary syndrome, especially the presence of ruptured plaque. PMID: 23532307 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression. PMID: 24503185 In conclusion, although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in breast cancer patients. PMID: 24696262 although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in epithelial ovarian cancer patients. PMID: 24722824 Tenascin-C-derived peptide TNIIIA2 highly enhances cell survival and platelet-derived growth factor (PDGF)-dependent cell proliferation through potentiated and sustained activation of integrin alpha5beta1. PMID: 24808173 Studied serum levels of Tn-C containing the FNIIIB (B+ Tn-C) or FNIIIC (C+ Tn-C) domain in heart failure patients. Analysis of Tn-C concentrations according to heart failure etiology revealed no significant differences. PMID: 25016707 serum levels elevated in scleroderma PMID: 23834524 Serum levels of MMP-9, TIMP-1 and B(+) Tn-C and tissue levels of B(+) Tn-C and ED-A(+) Fn are promising markers for risk assessment in dilated cardiomyopathy. PMID: 23998545

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.