Recombinant Human TEAD4 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8880P
Recombinant Human TEAD4 Protein (His tag)

Recombinant Human TEAD4 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8880P
Catalog No.: BLA-8880P

Product Overview

Host Species Human
Accession Q15561
Synonym EFTR 2 EFTR2 hRTEF 1B hRTEF1B MGC9014 OTTHUMP00000238119 OTTHUMP00000238122 OTTHUMP00000238124 Related to TEF 1 Related to TEF1 Related transcription enhancer factor 1B RTEF1 TCF13L1 TEA domain family member 4 TEAD 4 TEAD-4 TEAD4 TEAD4_HUMAN TEF 3 TEF3 TEFR 1 TEFR1 Transcription factor 13 (SV40 transcriptional enhancer factor) like 1 Transcription factor 13 like 1 Transcription factor 13-like 1 Transcription factor RTEF 1 Transcription factor RTEF-1 Transcription factor RTEF1 Transcriptional enhancer factor 1 related Transcriptional enhancer factor 3 Transcriptional enhancer factor TEF 3 Transcriptional enhancer factor TEF-3 Transcriptional enhancer factor TEF3
Description Recombinant Human TEAD4 Protein (His tag) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAK DKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGT SHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSK LWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDK FPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESP ENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINF IHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHG AQHHIYRLVKE
Molecular Weight 45 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed