Recombinant Human TEAD4 Protein (His tag)

Name: Recombinant Human TEAD4 Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-8880P
Availability: InStock

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	Q15561
Synonym	EFTR 2 EFTR2 hRTEF 1B hRTEF1B MGC9014 OTTHUMP00000238119 OTTHUMP00000238122 OTTHUMP00000238124 Related to TEF 1 Related to TEF1 Related transcription enhancer factor 1B RTEF1 TCF13L1 TEA domain family member 4 TEAD 4 TEAD-4 TEAD4 TEAD4_HUMAN TEF 3 TEF3 TEFR 1 TEFR1 Transcription factor 13 (SV40 transcriptional enhancer factor) like 1 Transcription factor 13 like 1 Transcription factor 13-like 1 Transcription factor RTEF 1 Transcription factor RTEF-1 Transcription factor RTEF1 Transcriptional enhancer factor 1 related Transcriptional enhancer factor 3 Transcriptional enhancer factor TEF 3 Transcriptional enhancer factor TEF-3 Transcriptional enhancer factor TEF3
Description	Recombinant Human TEAD4 Protein (His tag) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAK DKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGT SHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSK LWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDK FPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESP ENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINF IHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHG AQHHIYRLVKE
Molecular Weight	45 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.
Subcellular Location	Nucleus.
Database References	HGNC: 11717 OMIM: 601714 KEGG: hsa:7004 STRING: 9606.ENSP00000352926 UniGene: PMID: 27291620 Combining single site-directed mutagenesis and double mutant analyses, the authors conduct a detailed analysis on the role of several residues located at the YAP:TEAD interface. The results provide quantitative understanding of the interactions taking place at the YAP:TEAD interface and give insights into the formation of the YAP:TEAD complex and more particularly on the interaction between TEAD and the ohm-loop found ... PMID: 28430104 Studied the effect of TEAD4 acylation on its interaction with YAP and TAZ; found YAP and TAZ bind in a similar manner to both acylated and non-acylated TEAD4. Also found TEAD4 acylation significantly enhances its stability. PMID: 28960584 High TEF3 expression is associated with cell cycle progression and angiogenesis in colon cancer. PMID: 26885617 Osmotic stress promotes TEAD4 cytoplasmic translocation via p38 MAPK in a Hippo-independent manner. Stress-induced TEAD inhibition predominates YAP-activating signals and selectively suppresses YAP-driven cancer cell growth. PMID: 28752853 The transcription factor TEAD4 regulates a pro-metastasis transcription program in a YAP-independent manner in CRC, thus providing a novel mechanism of TEAD4 transcriptional regulation and its oncogenic role in CRC, independently of the Hippo pathway. PMID: 26387538 our work provides a structural basis for understanding the regulatory mechanism of TEAD4-mediated gene transcription PMID: 28368398 Our results suggest that TEAD4 plays a role in the pathophysiology of atypical teratoid/rhabdoid tumor, which represents a new insight into the biology of this aggressive tumor PMID: 27966820 It was found that the TEAD4-YAP complex in the nuclei may be related closely to transcriptions of G1 arrest-related genes. PMID: 28315328 Tead4 cooperates with AP1 transcription factors to coordinate target gene transcription. PMID: 26832411 TEAD4 and KLF5, in collaboration, promoted triple negative breast cancer cell proliferation and tumor growth in part by inhibiting p27 gene transcription PMID: 25970772 potential anti-oxidation gene and can prevent H2O2-induced endothelial cell oxidative damage by activating Klotho PMID: 26041389 TEAD4 overexpression induced p16 in HAoSMCs homozygous for the nonrisk coronary disease allele, but not for the risk allele. PMID: 26487755 the peptides TEF3-11-66 and TEF3-1197-434 functioned as two independent activation domains, suggesting that N-terminal domain of TEF3-1 also has transcriptional activation capacity PMID: 25687649 Edg-1 is a potential target gene of RTEF-1 and is involved in RTEF-1-induced angiogenesis in endothelial cells. PMID: 24520353 the multilevel perturbations of TEAD4 at epigenetic, transcriptional and posttranslational levels may contribute to GC development. PMID: 24325916 These data suggest that TFF3 and survivin expressions play a vital role in gastric cancer development, and these two proteins are important markers for prognosis in gastric cancer. PMID: 22996285 convergent optimization of the YAP/TAZ TEAD binding site suggests that the similarity in the affinities of binding of YAP to TEAD and of TAZ to TEAD is important for Hippo pathway functionality. PMID: 23780915 High TEAD4 expression is associated with Age-Related Macular Degeneration. PMID: 22761647 These results show that RTEF-1-stimulated IGFBP-1 expression may be central to the mechanism by which RTEF-1 attenuates blood glucose levels. PMID: 22843786 Blocking connexin 43 function inhibited RTEF-1-induced endothelial cell connections and aggregation PMID: 22652601 RTEF-1 plays an important role in FGFR1- stimulated vasodilatation. PMID: 22433836 RTEF-1 as a regulator of HIF-1alpha transcription PMID: 21540178 the RTEF-1-driven increase of VEGF-B plays an important role in communication between the endothelium and myocardium PMID: 21169295 TEF3, mainly its nuclear localization, is required for VEGF-A(165)-induced endothelial proliferation, migration, tube formation, and in vivo Matrigel angiogenesis. PMID: 21169383 Constitutive activation of alpha1-adrenergic signaling through the RTEF-1 transcription factor results in chronic elevation of PP1beta expression and connexin dephosphorylation. This mechanism may underlie some defects in cardiac conduction. PMID: 15520314 Novel RTEF-1 transcripts are present within human ocular vascular endothelial cells and mouse neural retina during normal and retinopathy of prematurity development, and alternatively spliced products are produced under hyperoxic and hypoxic conditions PMID: 17652751 The gain of function studies indicated that TEA domain family member 4 activate NR5A1 gene expression. PMID: 18579725 TEF3 mediates the expression of Down syndrome candidate region 1 isoform 1 (DSCR1-1L) in endothelial cells PMID: 18840614 The paper described several reasons to designate the putative translation initiation codon as the leucine (TTG) codon, which is 7 codons upstream from the isoleucine (ATT) codon. PMID: 8921372 The paper described that the ORF of TEF-3 initiates with an ATT codon encoding isoleucine. PMID: 8702974

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human TEAD4 Protein (His tag)

Recombinant Human TEAD4 Protein (His tag)

Product Overview

Target Details

FAQs