Recombinant Human Talin-1 (TLN1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10304P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Talin-1 (TLN1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10304P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Talin-1 (TLN1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9Y490
Target Symbol TLN1
Synonyms ILWEQ; Talin 1; Talin; Talin-1; TLN 1; TLN; Tln1; TLN1_HUMAN
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence MLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII
Expression Range 92-399aa
Protein Length Partial
Mol. Weight 37.8kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Probably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts.
Subcellular Location Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cell surface. Cell junction, focal adhesion.
Database References

HGNC: 11845

OMIM: 186745

KEGG: hsa:7094

STRING: 9606.ENSP00000316029

UniGene: PMID: 29936723

  • Calpain small subunit 1 (Capn4) overexpression increased the protein level of cleaved talin and and activated the focal adhesion kinase (FAK)/AKT/MAPK signaling in 786-O cells, while Capn4 silencing decreased the protein level of cleaved talin in Caki-1 cells. PMID: 29648579
  • Talin-1 induces proliferation and migration of vascular smooth muscle cells obtained from patients with thoracic aortic dissection. PMID: 28637452
  • Here, the authors show that cortical microtubule stabilization sites containing CLASPs, KIF21A, LL5beta and liprins are recruited to focal adhesions by the adaptor protein KANK1, which directly interacts with the major adhesion component, talin. Structural studies showed that the conserved KN domain in KANK1 binds to the talin rod domain R7. PMID: 27410476
  • Vinculin head-tail interaction is required on soft substrates to destabilize vinculin and talin in FAs, and to allow hMSCs branching. Another module involves paxillin and FAK, which soft substrates also destabilize, but independently of vinculin head-tail interaction. This multi-modularity may be key to allow a versatile response to complex biomechanical cues. PMID: 27169142
  • The central role of talin and vinculin in cell adhesions suggests that the disintegration of the tissue in atherosclerosis could be partially driven by downregulation of these genes, leading to loosening of cell-ECM interactions and remodeling of the tissue. PMID: 27816808
  • Application of these techniques to new talin biosensors reveals an intramolecular tension gradient across talin-1 that is established upon integrin-mediated cell adhesion. The tension gradient is actomyosin- and vinculin-dependent and sensitive to the rigidity of the extracellular environment PMID: 28945706
  • Our findings confirm the role of Talin-1 in carcinogenesis and provided a set of novel therapeutic targets for the treatment of hepatocellular carcinoma PMID: 28099903
  • These data show that TLN1 can act as a viral restriction factor that suppresses hepatitis B virus replication, and suggest that the HBx relieves this restriction by inducing TLN1 degradation. PMID: 27775586
  • The ERK pathway was responsible for these promoting effects of Talin1 knockdown in HCC cells. PMID: 28375585
  • This study showed that serum sTalin-1 levels were associated with a sustained increase in disability after MS attack but not with serum anti-Talin-1 antibody levels. PMID: 28284333
  • The Rap1-RIAM-talin axis of integrin activation and blood cell function PMID: 27207789
  • These findings suggested that Talin-1 protein was significantly upregulated in PCa tissues compared with that of BPH tissue and Talin-1 expression was an independent predictor for lymph node metastasis and biochemical recurrence of PCa. PMID: 27442684
  • Serum talin-1 had 97.7% sensitivity. PMID: 27644664
  • Both TLN-1 and TLN-2 levels correlate with tumorigenicity in human HCC, indicating that these molecules constitute important molecular targets for the diagnosis and/or treatment of hepatocellular carcinoma . PMID: 26822056
  • TLN1 significantly increases in refractory glioblastoma multiforme PMID: 26336988
  • Applying correlative imaging to link live cell and fixed immunofluorescence data on a single cell basis, we related per cell talin-1 levels to per cell measures quantitatively defining an array of cellular properties. PMID: 26000342
  • Disruption of the RIAM/lamellipodin-integrin-talin complex markedly impairs cell migration. PMID: 26419705
  • Our data demonstrate that high expression of Talin-1 is associated with significantly poorer OS and poorer DMFS in NPC and depletion of Talin-1 expression inhibited NPC cell migration and invasion. Talin-1 may serve as novel prognostic biomarker in NPC. PMID: 25925041
  • results identify talin as the primary determinant of FA nanoscale organization and suggest how multiple cellular forces may be integrated at adhesion sites PMID: 26283369
  • The activation of vinculin by stretched talin induces a positive feedback that reinforces the actin-talin-vinculin association. PMID: 24452080
  • Talin extension is a key step in sensing and responding to substrate stiffness at cell adhesion sites. PMID: 25142525
  • Data (including data from molecular dynamic simulations) suggest specific interactions between glycoprotein GPIIb/GPIIIa complex transmembrane/C-terminal domains and talin-1 in cell membrane environment during platelet activation. PMID: 24677266
  • phosphorylation of talin1 leading to beta1 integrin activation is a novel mechanism that increases metastatic potential of prostate cancer cells. PMID: 24793790
  • Data suggest that anionic lipids (such as phosphatidylinositol phosphates) play crucial role in localization of peripheral membrane proteins (such as TLN1, auxilin-1, and PTEN [phosphatase and tensin homolog]). [review-like article] PMID: 25233425
  • Low levels of Talin-1 expression are correlated with increased invasion and migration in liver cancer. PMID: 24761880
  • Data indicate the role of vinculin in inducing the talin mediated integrin activation. PMID: 24446374
  • MMP-2 regulates human platelet activation through hydrolysis of talin PMID: 24136115
  • Talin has a role in regulating moesin-NHE-1 recruitment to invadopodia in breast cancer PMID: 24891603
  • miR-9 plays a role as a tumor suppressor in OSC by suppressing TLN1 expression. PMID: 23722670
  • These results indicate that mechanical forces loaded to focal adhesions (FAs) facilitate vinculin binding to talin at FAs. PMID: 24452377
  • High Serum talin-1 expression is associated with hepatocellular carcinoma. PMID: 23886189
  • Data indicate that KIF14 and TLN1 loss-of-function significantly enhanced chemosensitivity in four triple-negative breast cancer (TNBC) cell lines. PMID: 23479679
  • Talin1 has unique expression versus talin 2 in the heart and modifies the hypertrophic response to pressure overload. PMID: 23266827
  • CtsH-mediated processing of talin might promote cancer cell progression by affecting integrin alphaVbeta3 activation and adhesion strength PMID: 23204516
  • Agonist stimulation, talin-1, and kindlin-3 are crucial for alpha(IIb)beta(3) activation in a human megakaryoblastic cell line, CMK. PMID: 23022222
  • Kindlin-2 and talin head do not interact with one another but can bind simultaneously to the integrin beta(3) tail without enhancing or inhibiting the interaction of the other binding partner. PMID: 22648415
  • Low Talin1 is associated with hepatocelluar carcinoma. PMID: 22471464
  • Talin1 is required for inside-out activation of integrin beta1 during Bartonella henselae infection. PMID: 22045736
  • FAK promotes talin recruitment to nascent adhesions occurring independently of talin binding to beta1 integrins. PMID: 22270917
  • Talin1 is required for contact-dependent CD4-positive T cell proliferation in talin1 transgenic mice. Talin1 is not required for contact-independent CD4+ T cell proliferation. PMID: 22075696
  • We investigated the role of talin-1, kindlin-3, and alpha-actinin-1 in the upregulation of alpha(4)beta(1) integrin affinity and consequent inflammatory leukocyte adhesive events PMID: 21911599
  • Talin-1 upregulation is associated with disease progression in hepatocellular carcinoma. Thus, it may serve as a prognostic marker. PMID: 21846996
  • Adhesions within the carcinoma matrix create a matrix environment in which exposure to cisplatin induces proliferation through the function of integrin beta, talin and FAK pathways that regulate NF-kB nuclear activity. PMID: 21720550
  • Talin-1 and vinculin negatively affect tyrosine phosphorylation of paxillin, a novel positive regulator of HIV-1 infection, and impose an early block to infection by distinct retroviruses. PMID: 21763488
  • We show that sequential cleavage of C-terminal amino acids from the beta(2) cytoplasmic tail of LFA-1, by CatX, enhances binding of the adaptor protein talin to LFA-1 and triggers formation of the latter's high-affinity form PMID: 21454358
  • This review discusses the general function of talin 1 and talin 2, as well as vinculin/metavinulin, with emphasis on what is understood about their role in the cardiac myocyte and in whole heart. PMID: 19952892
  • Studies suggest that the perturbed orientation of talin relative to the membrane in the F2 mutant would be expected to in turn perturb talin/integrin interactions. PMID: 20947017
  • Data from talin crystal structure reveal a novel FERM domain with a linear domain arrangement, plus an additional domain F0 packed against F1. PMID: 20947018
  • Rap1-mediated activation of alpha(M)beta(2) in macrophages shares both common and distinct features from Rap1 activation of alpha(IIb)beta(3) expressed in CHO cells. PMID: 20665668
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed