Recombinant Human T-Lymphocyte Activation Antigen Cd86 (CD86) Protein (His), Active

Name: Recombinant Human T-Lymphocyte Activation Antigen Cd86 (CD86) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05629P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Co-stimulatory receptors, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human T-Lymphocyte Activation Antigen Cd86 (CD86) Protein (His), Active is produced by our Mammalian cell expression system. This is a extracellular protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human CTLA-4 in functional ELISA is less than 20 ug/ml.
Uniprotkb	P42081
Target Symbol	CD86
Synonyms	CD86; CD28LG2; T-lymphocyte activation antigen CD86; Activation B7-2 antigen; B70; BU63; CTLA-4 counter-receptor B7.2; FUN-1; CD antigen CD86
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Expression Range	24-247aa
Protein Length	Extracellular Domain
Mol. Weight	26.69 kDa
Research Area	Immunology
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Also involved in the regulation of B cells function, plays a role in regulating the level of IgG(1) produced. Upon CD40 engagement, activates NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation.; Interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.; (Microbial infection) Acts as a receptor for adenovirus subgroup B.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Database References	HGNC: 1705 OMIM: 601020 KEGG: hsa:942 STRING: 9606.ENSP00000332049 UniGene: PMID: 28067225 this study shows that recipients' CD86 gene polymorphisms influence the overall survival after allogeneic hematopoietic stem cell transplantation and, together with CTLA-4 polymorphisms, might be considered a risk factor for acute graft versus host disease PMID: 29577049 results strongly suggest that CD40 and CD86 play a role in the pathophysiology of oral inflammatory diseases such as OLP PMID: 28904313 Our results reveal a role for B7-2 as obligatory receptor for superantigens. B7-2 homodimer interface mimotopes prevent superantigen lethality by blocking the superantigen-host costimulatory receptor interaction. PMID: 27708164 Our study reports a novel association of SNPs within CD86 and CTLA4 genes with pemphigus. The CD86 rs1129055 A allele appears to confer susceptibility to Pemphigus vulgaris but not to pemphigus foliaceus. PMID: 28274366 Our data demonstrate that CML patients with high CD86(+)pDC counts have a higher risk of relapse after TKI discontinuation. PMID: 28074067 IL-6, DEC205, and CD86 can be predictive biomarkers for the respiratory and immune effects of ambient PM2.5. PMID: 28056587 the upregulation of CD86 but not CD80 and PD-L1 on CD68+ cells in the liver of HBV-infected patients, observed in our study, suggest that the profile of CD68+ cells does not support the induction of proper Th1 responses that are needed to clear HBV infection. This might provide an explanation for the absence of potent HBV-specific T cells during chronic HBV infection. PMID: 27348308 CD86 variants association with susceptibility to multiple sclerosis in Iranian population. PMID: 28079472 B-cells from patients tolerant to the graft maintained higher IL-10 production after CD40 ligation, which correlates with lower CD86 expression compared to patients with chronic rejection. PMID: 26795594 TLR2, TLR4 and CD86 gene polymorphisms are associated with Recurrent aphthous stomatitis. PMID: 25482673 The SNP CD40 -1C>T was associated with the IgG response against PvDBP, whereas IgG antibody titers against PvMSP-119 were influenced by the polymorphism CD86 +1057G>A. PMID: 26901523 PD-L1 expression and the PD-L1/CD86 ratio in CD14(++)CD16(+) monocytes were higher during chronic hepatitis C virus infection. PMID: 24531620 Data show that induction of CD86 antigen expression on monocytes by human beta Defensin-3 (hBD-3) is suppressed by P2X7 purinoceptor (P2X7R) antagonist. PMID: 26416278 analysis of the expression of TLR-9, CD86, and CD95 in circulating B cells of patients with chronic viral hepatitis B or C before and after antiviral therapy PMID: 25892855 Polymorphisms in CD86 gene have diverse effects on the pathogenesis of pneumonia-induced sepsis. PMID: 25129060 CD86 +1057G/A polymorphism may be not associated with the genetic susceptibility to chronic immune thrombocytopenia in a Chinese population. PMID: 24897540 CD86 polymorphisms are associated with susceptibility to pneumonia-induced sepsis and may affect gene expression in monocytes. PMID: 25912130 CD86 polymorphisms (rs1129055) may have protective effects on cancer risk in Asians and that CD86 polymorphisms (rs17281995) is likely to contribute to risk of cancer, particularly colorectal cancer in Caucasians. PMID: 25369324 Results support a CTLA4-Ig/CD86 interaction on gammaIFN and IL-17 activated endothelial cells that modulates the expression of VEGFR-2 and ICAM1. PMID: 25896473 B7-2 costimulation and intracellular indoleamine 2,3-dioxygenase expression is reduced in umbilical cord blood as compared to adult peripheral blood. PMID: 24930629 Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD86. PMID: 24981893 the higher levels of sCTLA-4 and CD86 in B-ALL patients might be candidate parameters for poor prognosis and may serve to refine treatment stratification with intensification of therapy in those patients prone to relapse. PMID: 24283754 no statistically significant difference between brucellosis patients and controls in the allele and genotype distributions of CTLA4, +49A/G (P = 0.859) and CD86, +2379G/C (P = 0.476) was found. PMID: 24298899 Cirrhotic patients with type 2 diabetes have increased expression of monocytic CD86 in comparison with cirrhotic non-diabetic, diabetic and healthy controls. This increases significantly with increase of the stage of the Child-Pugh score. PMID: 24378263 Provide evidence for an involvement of CD40+ and CD86+ B cells in the incidence of stroke and suggest that both pathogenic and protective B cell subsets exist. PMID: 24202305 Our results indicate that the methylation pattern in the CD86 promoter and CpG island is closely related to the expression of this co-stimulatory molecule in keratinocytes. PMID: 23867827 We failed to find any significant association of the 2 CD86 SNPs with RA. PMID: 23661460 Myeloid leukemia cells with a B7-2(+) subpopulation provoke Th-cell responses and become immuno-suppressive through the modulation of B7 ligands. PMID: 23175469 The frequency of the CD86 gene +1057A allele was significantly higher in pancreatic cancer cases than in controls. PMID: 22821131 CD86 and IL-12p70 are key players for T helper 1 polarization and natural killer cell activation by Toll-like receptor-induced dendritic cells. PMID: 22962607 Interaction of CD28 with B7 costimulatory antigen promotes proliferation and survival of activated gammadelta T cells following Plasmodium infection. PMID: 22732586 these results reveal the critical importance of the cytoskeleton-dependent CD86 polarization to the IS and more specifically the K4 motif for effective co-signaling. PMID: 22659416 CD86 represents an important tool for subdividing HSCs in several circumstances, identifying those unlikely to generate a full spectrum of hematopoietic cells. PMID: 22371880 Phe119 and Ser120 in the MIR2 ITM region and Asp244 in the B7-2 JM region contribute to the recognition of B7-2 by MIR2. PMID: 22379101 The +1057G/A polymorphism of the CD86 gene is associated with increased susceptibility to Ewing's sarcoma. PMID: 21870962 Data suggest that expression of CD86, CD80, and CD40 on dendritic cells in normal endometrium is higher than on tumor infiltrating dendritic cells in endometrioid adenocarcinoma; this may reflect roles in antigen presentation/tumor escape. PMID: 22142817 primary liver disease could influence the pre-transplantation levels of sCD86 and sCD95L. High pre-transplantation serum levels of sCD86 could favor the development of episodes of acute rejection. PMID: 22182632 IL-2 upregulates CD86 expression on human CD4(+) and CD8(+) T cells via a receptor-dependent mechanism that involves the NFAT and mammalian target of rapamycin pathways. PMID: 22246628 Yeast-derived beta-glucan lacks cytotoxic effects towards B-lymphoma cells but up-regulation of CD86 suggests maturation of the cells via dectin-1 by the carbohydrate PMID: 22199280 the +1057G/A polymorphism of the CD86 gene is associated with increased susceptibility to osteosarcoma PMID: 21563968 Parasite-induced B7-2 is dependent on Jun N-terminal protein kinase (JNK) but not extracellular signal-regulated kinase or p38 signaling; its expression on human peripheral blood monocytes is dependent on JNK signaling. PMID: 21911468 AA genotype and A allele of CD86 +1057G>A polymorphism may confer a protection against acute kidney allograft rejection in Tunisian patients. PMID: 21525579 Allergen exposure needs to cause weak or moderate cytotoxicity for DD86 and CD54 expression. PMID: 21628959 After surgery the rate of monocytes expressing B7-2 decreased in all the patients PMID: 21540807 genetic polymorphism is associated with risk or protection for chronic obstructive pulmonary disease in Chinese population PMID: 20732370 In the absence of irradiated M. tuberculosis, dendritic cells consist in a major DC-SIGN(high)/CD86(low) and minor DC-SIGN(low)/CD86(high) subpopulations, whereas in the presence of bacteria, there is an enrichment of DC-SIGN(low)/CD86(high) population. PMID: 20212510 In active ulcerative colitis CD86 and ICOS were over-expressed in the intestinal epithelial cells and lamina propria mononuclear cells. PMID: 20388394 Increased amount of CD86 or ICOS positive lamina propria mononuclear cells and enterocytes suggests that co-stimulatory molecules may play a role in the pathogenesis of Crohn disease. PMID: 20019769 Expansion of donor-derived lymphocytic choriomeningitis virus (LCMV)-specific CD4+ and CD8+ T cells is significantly impaired in B7.1/B7.2-deficient T cell receptor (TCR)transgenic recipients, compared with wild-type. PMID: 20601595

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.