Recombinant Human T-Cell Surface Glycoprotein Cd3 Gamma Chain (CD3G) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-00535P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human T-Cell Surface Glycoprotein Cd3 Gamma Chain (CD3G) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-00535P
Regular price $549.00 Sale price $240.00Save $309
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human T-Cell Surface Glycoprotein Cd3 Gamma Chain (CD3G) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P09693
Target Symbol CD3G
Synonyms (T-cell receptor T3 gamma chain)(CD antigen CD3g)
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
Expression Range 23-116aa
Protein Length Partial
Mol. Weight 18.2 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.
Subcellular Location Cell membrane; Single-pass type I membrane protein.
Database References

HGNC: 1675

OMIM: 186740

KEGG: hsa:917

STRING: 9606.ENSP00000431445

UniGene: PMID: 25957593

  • The study identifies an important role of the CD3gamma dileucine motif in T-cell development most probably mediated by its fine-tuning of pre-TCR and TCR expression, down-regulation and signaling. PMID: 25920998
  • HER2/CD3 BsAb efficiently inhibited the growth of breast cancer tissue by activating and inducing the proliferation of tumor tissue infiltrating lymphocytes. PMID: 25760691
  • Low cord blood Foxp3/CD3gamma mRNA ratios are highly predictive for early allergy development. PMID: 25113399
  • Data indicate that the high CD68/CD3 ratio identifies a bad prognosis group among muscle-invasive urothelial carcinoma (UC). cases. PMID: 24794251
  • Case Report: T-cell lymphoblastic leukemia/lymphoma with t(7;14)(p15;q32) [TCRgamma-TCL1A translocation] confirmed by FISH. PMID: 24966976
  • The results suggest that CD3G should be studied as a candidate gene for autoimmunity and that CD3gamma deficiency should be considered among other primary immunodeficiencies with predominantly autoimmune manifestations. PMID: 24910257
  • deficiency results in autoimmunity PMID: 23590417
  • In conclusion, TCR-gamma expression seems to be rare and is confined to cytotoxic primary cutaneous T-cell lymphomas PMID: 23348211
  • roles of CD3G polymorphisms in predisposition for HCC PMID: 22731821
  • Data show that the expressions of CD3, CD4 were significantly associated with overall survival(OS) of non-small cell lung cancer (NSCLC) patients. PMID: 22482414
  • A transgenic T cell receptor gammadelta-low expressing subset of T cells accumulates in mouse epidermis after IL-23 injections. PMID: 21984702
  • Data show that TCRzeta phosphorylation signal pathways were affected in CD3gamma(-/-) primary and HVS-transformed T cells. PMID: 21764047
  • CD3gamma and CD3delta evolved from a common precursor gene to optimize major histocompatibility antigen (MHC)-triggered alphabeta T cell receptor activation. PMID: 20660709
  • human CD3gamma has specific NFAT binding motifs that differentially bind NFATc1, NFATc2, and NF-kappa B p50 PMID: 12374807
  • CD3 gamma contributes to, but is not absolutely required for, the regulation of T cell receptor trafficking in resting and antigen-stimulated mature T lymphocytes. PMID: 12794121
  • there is one molecule each of CD3delta and CD3gamma in the surface TCR/CD3 complex PMID: 15459203
  • significant rigidity was observed in use of the (D/E)xxxL(L/I) motif in CD3gamma, due to an absolute requirement for the position of this signal in the context of the TCR complex and for a highly conserved lysine residue, K128, not present in CD3delta PMID: 15778375
  • The CD3 gamma gene promoter is lymphoid specific, initiates transcription from multiple start sites and contains two core promoters capable of recruiting the general transcription machinery through specificity protein binding motifs. PMID: 15879122
  • Several amino acids are essential for an optimal association between CD3gamma and CD3 and the assembly of a cell-surface expressed TCR-CD3deltagammazeta2 complex. PMID: 16916653
  • The CD3 gamma immune recognition receptor cytoplasmic domain binds to acidic and mixed phospholipid vesicles with a binding strength that correlates with the protein net charge and the presence of clustered basic amino acid residues. PMID: 17176095
  • HTLV-I infection initiates a process leading to a complete loss of CD3 membrane expression by an epigenetic mechanism which continues along time, despite an early silencing of the viral genome. PMID: 17822534
  • (Pre)malignant transformation in refractory celiac disease type II correlates with defective synthesis or defective association of the TCR chains, resulting in loss of surface TCR-CD3 expression PMID: 18815285
  • human eosinophils express a functional gammadeltaTCR/CD3 with similar, but not identical, characteristics to gammadeltaTCR from gammadeltaT cells PMID: 19536290
  • In this review, some of the genetic and epigenetic factors that determine the correct assembly and structure of the TCR/CD3 complex are summarized--REVIEW PMID: 19860678
  • Protein level controlled by OTHER KINASES PROTEINS PMID: 1709425
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed