Recombinant Human T-Cell-Specific Surface Glycoprotein Cd28 (CD28) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-06158P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human T-Cell-Specific Surface Glycoprotein Cd28 (CD28) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-06158P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human T-Cell-Specific Surface Glycoprotein Cd28 (CD28) Protein (hFc) is produced by our Mammalian cell expression system. This is a extracellular protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P10747 |
| Target Symbol | CD28 |
| Synonyms | CD28; T-cell-specific surface glycoprotein CD28; TP44; CD antigen CD28 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Target Protein Sequence | NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
| Expression Range | 19-152aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 44.1 |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. |
| Subcellular Location | Membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell surface. |
| Database References | HGNC: 1653 OMIM: 186760 KEGG: hsa:940 STRING: 9606.ENSP00000324890 UniGene: PMID: 28673752 |
