Recombinant Human T-Cell Antigen Cd7 (CD7) Protein (hFc-Myc), Active



Recombinant Human T-Cell Antigen Cd7 (CD7) Protein (hFc-Myc), Active
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human T-Cell Antigen Cd7 (CD7) Protein (hFc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1 , the EC 50 is 1.236-1.773 ng/ml. 2. Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay. |
Uniprotkb | P09564 |
Target Symbol | CD7 |
Synonyms | (GP40)(T-cell leukemia antigen)(T-cell surface antigen Leu-9)(TP41) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc-Myc |
Target Protein Sequence | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
Expression Range | 26-180aa |
Protein Length | Partial |
Mol. Weight | 46.5 kDa |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Not yet known. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | HGNC: 1695 OMIM: 186820 KEGG: hsa:924 STRING: 9606.ENSP00000312027 UniGene: PMID: 25679063 |