Recombinant Human Syndecan-4 (SDC4) Protein (His-SUMO)

Name: Recombinant Human Syndecan-4 (SDC4) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09342P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Syndecan-4 (SDC4) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P31431
Target Symbol	SDC4
Synonyms	Amphiglycan; MGC22217; OTTHUMP00000031788; ryudocan amphiglycan; Ryudocan; Ryudocan core protein; SDC 4; Sdc4; SDC4_HUMAN; SYND 4; SYND4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan proteoglycan 4; Syndecan-4; Syndecan4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
Expression Range	19-145aa
Protein Length	Extracellular Domain
Mol. Weight	29.9kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP.
Subcellular Location	[Isoform 1]: Membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Secreted.
Protein Families	Syndecan proteoglycan family
Database References	HGNC: 10661 OMIM: 600017 KEGG: hsa:6385 STRING: 9606.ENSP00000361818 UniGene: Hs.632267
Tissue Specificity	Expressed in epithelial and fibroblastic cells.

Gene Functions References

SDC4 gene silencing affects cell Epithelial Mesenchymal Transition and apoptosis of papillary thyroid cancer through the Wnt/beta-catenin signaling pathway. PMID: 30165731
Downregulation of SDC-4 inhibited FGF signaling through the blockade of ERK1/2 and PI3K/Akt/mTOR activation, thus suppressing cell proliferation and migration. PMID: 28703800
studies are required to show if syndecan-4 concentrations can be marker for prognosis assessment or disease progression PMID: 29232393
Data provide evidence that SDC4 plays important roles in normal physiology of intervertebral disc and cartilage through controlling growth factor signaling and matrix homeostasis. However, several studies to date clearly show that in diseased joints, SDC4 and inflammatory cytokines IL-1beta and TNF-alpha form a positive feedback loop, wherein they control each other's expression and/or activity. [review] PMID: 26796346
This study demonstrates that the shedding of synd4 from Endothelial progenitor cells (EPCs) plays a key role in advanced glycation end products-mediated dysfunction of EPC migration and homing. PMID: 27662820
the Ser179Glu mutant of SDC-4 binds strongly Tiam1, a Rac1-GEF reducing Rac1-GTP by 3-fold in MCF-7 breast adenocarcinoma cells. PMID: 29121646
Syndecan 4 is the biomarker independently distinguishing Heart Failure with preserved ejection fraction and Heart Failure with reduced ejection fraction. PMID: 27448535
The upregulation of syndecan-4 in the eutopic endometrium of endometriosis patients may facilitate the pathogenetic process by promoting invasive cell growth via Rac1, MMP3, and ATF-2. PMID: 27041028
Sdc4 has been identified as a mycobacterial attachment receptor on alveolar epithelial cells. PMID: 27279134
Study has demonstrated that SDC-4 expression was increased in sera and skin of atopic dermatitis (AD) patients, suggesting that SDC-4 may contribute to the development of AD. PMID: 27591995
the present study demonstrated that synd4 was involved in the chemotactic migration of ECs in vitro and in vivo. PMID: 27541034
results suggest that SDC4 alleles affect lipid profile in elderly subjects and may in part mediate the link between LDL-C and longevity. PMID: 26254886
Synd4 shedding is a molecular pathological alteration in the development and maintenance of inflammation-associated atrial fibrillation. PMID: 26261514
Dynamic catch of a Thy-1-integrin alpha5beta1+syndecan-4 trimolecular complex explains extraordinary cancer cell adhesion to the vascular endothelium. PMID: 25216363
Syndecan-4 polymorphisms were associated with essential hypertension, body mass index, and coronary artery disease prevalence in the Tampere adult population cardiovascular risk study. PMID: 25410619
No association was found with SDC4 and breast cancer. PMID: 25361632
Data indicate that depletion of syndecan 4 (S4) in umbilical vein endothelial cells (HUVECs) using shRNA inhibited flow-induced alignment in vitro, which was rescued by re-expression of S4. PMID: 25404299
define a role for TG2 activity at the surface of human macrophages in multiple stages of AC clearance and we propose that TG2, in association with heparan sulphates may exert its effect on AC clearance via a mechanism involving the crosslinking of CD44 PMID: 25449226
syndecan 4 is the predominant heparan sulfate proteoglycan in the glomerular endothelial cells glycocalyx PMID: 25122554
TGM2 up-regulation along with ITGB1 and SDC4 plays an important role in the development of RCC tumors and advanced RCC with metastasis PMID: 23499501
Sdc4 is necessary for activation of the integrin during chemokinesis induced by EGF. PMID: 25202019
in healthy discs, SDC4, through its heparan sulfate side chains, contributes to maintenance of the hypoxic tissue niche by controlling baseline expression of Sox9. PMID: 24558194
High glucose modifies TRPC6 channels and ROS production via SDC-4 in human podocytes. PMID: 24942878
The cytoplasmic V domain of syndecan-4 made a significant contribution to the cellular uptake of octaarginine, whereas the cytoplasmic C1 and C2 domains were not involved in the process. PMID: 24632200
syndecan-4 is differentially expressed in seminomas and nonseminomatous germ cell tumours and might be a useful marker. PMID: 23844358
The more upgraded the NYHA grading, the higher level of serum syndecan-4 protein. PMID: 23948417
Syndecan-4 expression and shedding were increased in failing human myocardium. PMID: 23374111
EGFR are the key mediators of SDC-4 expression in MCF-7 cells. PMID: 23374155
Increased expression of SDC4 and FN may be underlying molecular alteration of osteo-sarcoma which accounts for more aggressive clinical behaviour. PMID: 22531343
studies identify S4 as a regulator of MAPK signaling and address the question of how distinct classes of FGFRs individually contribute to signal transduction in endothelial cells PMID: 22569333
By accruing more syndecan-4 on their surface and also shedding it during Th1 cytokine-driven inflammation, asthmatic airway smooth muscle cells may regulate inflammation and remodeling locally and alter the responsiveness of the airways in asthma. PMID: 22268118
in nucleus pulposus, TNF-alpha and IL-1beta regulate SDC4 expression, which plays a key role in pathogenesis of degenerative disc disease by promoting aggrecan degradation by ADAMTS-5. PMID: 21949132
SD-4 bearing distinct heparan sulfate moieties plays a pathogenic role in Sezary syndrome and may be targeted for treatment. PMID: 21252093
Expression of syndecan 4 in healthy human breast tissue during menstrual cycle. PMID: 20398359
In dendritic cells, lysophosphatidylcholine-induced phosphorylation of SDC4 by PKCdelta results in a functional inactivation of SDC4 and decreases adhesion and motility. PMID: 20607801
Data found that Wnt5a reduces cell surface levels and promotes ubiquitination and degradation of SDC4. PMID: 20639201
SDC4 promotes cytokinesis in a phosphorylation-dependent manner in MCF-7 breast adenocarcinoma cells. The serine179-phosphorylation and the ectodomain shedding of SDC4 changed periodically in a cell cycle-dependent way. PMID: 20229236
The expression of syndecan-4 protein was significantly enhanced by TNF-alpha in HUVECs. PMID: 17545042
The down-regulation of syndecan-4, a heparan sulfate proteoglycan, decreased SDF-1/CXCL12-mediated HeLa cell invasion. PMID: 19695308
Study identified an overrepresentation of focal amplifications of known (FGFR3, CCND1, MYC, MDM2) and novel candidate genes (MYBL2, YWHAB and SDC4) in stage Ta bladder carcinoma. PMID: 19821490
Syndecan-4 may be a sensor of tension exerted on the matrix [review] PMID: 19538537
Syndecan-4 mediates antithrombin-induced chemotaxis of human peripheral blood lymphocytes and monocytes PMID: 11801740
Clustering induces redistribution of syndecan-4 core protein into raft membrane domains PMID: 11889131
Syndecan-4 core protein mediates the effects of fibroblast growth factor (FGF)2 on cell function. PKCalpha activation and PDZ-mediated formation of a serine/threonine phosphatase-containing complex by syndecan-4 are downstream events of FGF2 signaling. PMID: 12011116
SDC4 regulates inositol phospholipid binding and signaling PMID: 12377772
the focal adhesion component alpha-actinin interacts with syndecan-4 in a beta-integrin-independent manner PMID: 12493766
Syndecan-4 can promote cell spreading in a beta(1) integrin-dependent fashion through PKCalpha and RhoA PMID: 12509413
endotoxin-induced adhesion of leukocytes to endothelium can be reversed by ligation of syndecan-4 with antithrombin's heparin-binding site PMID: 14652650
syndecan-4/CXCR4 complex is likely a functional unit involved in SDF-1 binding PMID: 15033938
human trabecular meshwork cells express only syndecan-1, and not syndecan-4, at the cell surface, and focal adhesion and stress fiber formation occur independent of syndecan-4 PMID: 15572366

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.