Recombinant Human Syndecan-2 (SDC2) Protein (His), Active

Name: Recombinant Human Syndecan-2 (SDC2) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05609P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Syndecan-2 (SDC2) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.
Uniprotkb	P34741
Target Symbol	SDC2
Synonyms	SDC2; HSPG1; Syndecan-2; SYND2; Fibroglycan; Heparan sulfate proteoglycan core protein; HSPG; CD antigen CD362
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE
Expression Range	19-144aa
Protein Length	Partial
Mol. Weight	14.98 kDa
Research Area	Signal Transduction
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Syndecan proteoglycan family
Database References	HGNC: 10659 OMIM: 142460 KEGG: hsa:6383 STRING: 9606.ENSP00000307046 UniGene: PMID: 28753106 Emerging roles of SDC2 in epithelial and mesenchymal cancer progression has been summarized. (Review) PMID: 28940845 data suggest that syndecan-2 induces extracellular shedding of E-cadherin and supports the acquisition of a fibroblast-like morphology by regulating MMP-7 expression in a colon cancer cell line PMID: 27270030 SDC2 is overexpressed in Leri's pleonosteosis. The minor allele of a missense SDC2 variant, p.Ser71Thr, could confer protection against systemic sclerosis. PMID: 24442880 In this review we considered the function of syndecan-2, the structure of syndecan-2 and its role in the formation of amyloid plaques. PMID: 25916113 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line. PMID: 24804215 HIV matrix protein p17 is pro-fibrogenic through its interactions both with CXCR2 and syndecan-2 on activated HSCs PMID: 24736615 The results demonstrate the importance of PDZ-binding domain of syndecan-2 for controlling LFA-1 affinity and cell adhesion. PMID: 24662262 SDC2 expression was higher in skin melnaoma cells. It enhanced tyrosinase activity by increasing the membrane and melanosome localization of protein kinase CbetaII. UVB-induced up-regulation was required for UVB-induced melanin synthesis. PMID: 24472179 syndecan 2 shows no changes associated to histological grade of Prostate cancer PMID: 24424718 RhoA, but not RhoC was shown to be essential for the anchored phenotype of breast carcinoma cells that accompanied siRNA-mediated loss of syndecan-2. PMID: 24447566 RKIP, LOX and SDC2 are coordinately regulated and collectively encompass a prognostic signature for metastasis-free survival in ER-negative breast cancer patients PMID: 23975428 Taken together, these data suggest that IL-1alpha regulates extracellular domain shedding of syndecan-2 through regulation of the MAP kinase-mediated MMP-7 expression in colon cancer cells. PMID: 24613844 Clinical validation of SDC2 methylation in serum DNA by quantitative methylation-specific PCR demonstrated a high sensitivity of 87.0% (95% CI, 80.0% to 92.3%) in detecting cancers. PMID: 23747112 DNA from 4 HPV positive and 4 HPV negative fresh frozen primary HNSCC were subject to comprehensive genome-wide methylation profiling.Pathway analysis of 1168 methylated genes showed 8 signal transduction pathways (SDC2) of which 62% are hypermethylated. PMID: 23736812 Taken together, these results suggest that the extracellular domain of syndecan-2 regulates the interaction of HCT116 human colon carcinoma cells with fibronectin. PMID: 23333331 SDC-2 modulates TGFbeta2 transcriptional regulation via Smad2 signaling to facilitate fibrosarcoma cell adhesion. PMID: 23297089 The repression of syndecan-2 by Wnt/beta-catenin/TCF signaling contributes to the resistance of osteosarcoma cells to doxorubicin. PMID: 22550000 lower TCR/CD3 surface levels caused by syndecan-2 led to reduced TCR/CD3 responsiveness PMID: 22881146 MC1R regulates melanoma cell migration via inhibition of syndecan-2 expression. PMID: 22493442 SDC-2 is a novel (perineural) invasion-associated gene in PDAC which cooperates with K-ras to induce a more invasive phenotype. PMID: 22471946 Notch receptors control their own activity by inducing the expression of syndecan-2, which then acts to propagate Notch signaling by direct receptor interaction. PMID: 22437834 a specific glycochain is a receptor for dengue virus strain DEN2 16681 PMID: 22170634 the data suggest that MMP-7 directly mediates shedding of syndecan-2 from colon cancer cells. PMID: 22227189 Here the protein tyrosine phosphatase receptor CD148 is shown to be a key intermediary in cell adhesion to syndecan-2 extracellular domain, with downstream beta1 integrin-mediated adhesion and cytoskeletal organization. PMID: 21813734 syndecan-2 was expressed preferentially in basal cells in benign tissue. In prostate cancer samples, syndecan 2 was expressed in granular-cytoplasmic localisation. PMID: 21317913 HIV-1 p17 matrix protein interacts with heparan sulfate side chain of CD44v3, syndecan-2, and syndecan-4 proteoglycans expressed on human activated CD4+ T cells affecting tumor necrosis factor alpha and interleukin 2 production. PMID: 21482826 the cytoplasmic domain of syndecan-2 regulates colon cancer cell migration via interaction with syntenin-1. PMID: 21569759 The findings demonstrate that LRP1 and HSPG function in a cooperative manner to mediate cellular Abeta uptake and define a major pathway through which Abeta gains entry to neuronal cells. PMID: 21289173 syndecan-2 and syndecan-4 regulate the compensatory effect of TG-FN on osteoblast cell adhesion and actin cytoskeletal formation in the presence of RGD peptides. PMID: 21036168 RGD-independent cell adhesion via a tissue transglutaminase 2-fibronectin matrix promotes fibronectin fibril deposition and requires syndecan-4/2 and {alpha}5{beta}1 integrin co-signaling. PMID: 20929862 Results support a potential role for syndecan-2 in pancreatic carcinogenesis and cancer progression. Expression of syndecan-2 might serve as a prognostic marker. PMID: 20683009 Study results supported the potential role of SDC2 in prostatic carcinogenesis and cancer progression. PMID: 19786981 these results suggest that syndecan-2 regulates cell migration of colon carcinoma cells through Tiam1-dependent Rac activation in colon cancer cells. PMID: 19962968 syndecan's interactions with both CASK and neurofibromin are dependent on syndecan homodimerization. PMID: 20006588 Identification of integrin alpha(M)beta(2) as an adhesion receptor on human peripheral blood monocytes for Cyr61 and connective tissue growth factor: immediate-early gene products expressed in atherosclerotic lesions.(integrin alpha(M)beta(2)) PMID: 12036876 role in mediating adhesion and proliferation of colon carcinoma cells PMID: 12055189 Ezrin N-terminal domain binds to the syndecan-2 cytoplasmic domain with an estimated K(D) of 0.71 microM and without the requirement of other proteins PMID: 12860416 Mechanisms for the regulation of HSPG have been studied. PMID: 12860968 Interleukin-8 binds to syndecan-2 on vascular endothelial cells. PMID: 14527339 the HSPG T allele is a risk factor for the development of severe diabetic nephropathy in type 2 diabetic patients PMID: 14674716 Syndecan-2 induces osteoblastic cell apoptosis through the JNK/Bax apoptotic pathway and the cytoplasmic domain of syndecan-2 is required for this action. PMID: 15936998 the transmembrane domains are sufficient for inducing dimerization and transmembrane domain-induced oligomerization is crucial for syndecan-2 and syndecan-4 functions PMID: 16253987 molecular complex most likely to obstruct RACK1 for functional attachment at syndecan-2, as revealed in cells transfected with oncogenic ras PMID: 16997272 HSPGs are expressed on the membrane of myeloid leukemic cell lineages. PMID: 17035092 heparanase-1 expression and heparan sulphate proteoglycan degradation are induced by estradiol in human endometrium PMID: 17261577 these data suggested that both HSPG and CD81 are important for HCV entry. PMID: 17457918 HSPG modulation of BMP signaling in myositis ossificans cells is reported. PMID: 17516498 syndecan-2 acts as a suppressor for MMP-2 activation, causing suppression of metastasis PMID: 17623663 There are pronounced tubulointerstitial HSPG alterations in primary kidney disease, which may affect the inflammatory response. PMID: 18032547

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.