Recombinant Human Synaptosomal-Associated Protein 29 (SNAP29) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09127P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Synaptosomal-Associated Protein 29 (SNAP29) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09127P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Synaptosomal-Associated Protein 29 (SNAP29) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O95721 |
| Target Symbol | SNAP29 |
| Synonyms | CEDNIK; FLJ21051; SNAP 29; SNAP-29; SNAP29; SNP29_HUMAN; Soluble 29 kDa NSF attachment protein; Synaptosomal associated protein 29; Synaptosomal associated protein 29kDa; Synaptosomal-associated protein 29; Vesicle membrane fusion protein SNAP 29; Vesicle membrane fusion protein SNAP29; Vesicle-membrane fusion protein SNAP-29 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
| Expression Range | 1-258aa |
| Protein Length | Full Length |
| Mol. Weight | 56.0kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions. |
| Subcellular Location | Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein. Cytoplasmic vesicle, autophagosome membrane; Peripheral membrane protein. Cell projection, cilium membrane; Peripheral membrane protein. |
| Protein Families | SNAP-25 family |
| Database References | HGNC: 11133 OMIM: 604202 KEGG: hsa:9342 STRING: 9606.ENSP00000215730 UniGene: PMID: 29454964 |
