Recombinant Human Swi/Snf Complex Subunit Smarcc1 (SMARCC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08571P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Swi/Snf Complex Subunit Smarcc1 (SMARCC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08571P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Swi/Snf Complex Subunit Smarcc1 (SMARCC1) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q92922 |
| Target Symbol | SMARCC1 |
| Synonyms | AI115498; BAF 155; BAF155; BRG 1 associated factor 155; BRG1 associated factor 155; BRG1-associated factor 155; Chromatin remodeling complex BAF155 subunit; CRACC 1; CRACC1; Mammalian chromatin remodeling complex BRG 1 associated factor 155; Mammalian chromatin remodeling complex BRG1 associated factor 155; Rsc 8; Rsc8; SMARC C1; SMARCC 1; SMARCC1; SMRC1_HUMAN; SRG 3; SRG3; SWI 3; SWI/SNF complex 155 kDa subunit; SWI/SNF complex subunit SMARCC1; SWI/SNF related matrix associated actin dependent regulator of chromatin c1; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily c member 1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1; SWI3 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-6His |
| Target Protein Sequence | IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL |
| Expression Range | 451-671aa |
| Protein Length | Partial |
| Mol. Weight | 27.5kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. May stimulate the ATPase activity of the catalytic subunit of the complex. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. |
| Subcellular Location | Nucleus. Cytoplasm. |
| Protein Families | SMARCC family |
| Database References | HGNC: 11104 OMIM: 601732 KEGG: hsa:6599 STRING: 9606.ENSP00000254480 UniGene: PMID: 30144500 |
