Recombinant Human Surfactant Protein D/SP-D

Name: Recombinant Human Surfactant Protein D/SP-D
Brand: Beta LifeScience
SKU: BLA-8638P
Availability: InStock

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P35247
Synonym	COLEC 7 COLEC7 Collectin-7 Collectin7 Lung surfactant protein D PSP D PSP-D PSP-D Surfactant protein D PSPD Pulmonary surfactant apoprotein Pulmonary surfactant associated protein D Pulmonary surfactant associated protein PSP-D Pulmonary surfactant-associated protein D SFTP 4 SFTP4 SFTPD SFTPD_HUMAN SP D SP-D Surfactant associated protein pulmonary 4 Surfactant protein D Surfactant pulmonary associated protein D
Description	Recombinant Human Surfactant Protein D/SP-D was expressed in HEK293. It is a Full length protein
Source	HEK293
AA Sequence	AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPG AAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGV PGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESG LPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGF VKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKT EGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRL VVCEFVDHHHHHH
Molecular Weight	37 kDa including tags
Purity	Greater than 95% SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. The lyo

Target Details

Target Function	Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
Subcellular Location	Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.
Protein Families	SFTPD family
Database References	HGNC: 10803 OMIM: 178635 KEGG: hsa:6441 STRING: 9606.ENSP00000361366 UniGene: PMID: 29425774 Assays that can separate SP-D proteolytic breakdown products or modified forms from naturally occurring SP-D trimers may result in optimal disease markers for pulmonary inflammatory diseases PMID: 28960651 the SPA and SPD levels in EBC were correlated with lung function, which contributed to COPD diagnosis. PMID: 28791362 Studied predictive value of surfactant protein D (SP-D) in lung cancer patients with interstitial lung disease induced by anticancer agents (ILD-AA). Results suggest that SP-D level change was a risk factor for mortality in patients with ILD-AA, and that SP-D might be a predictive prognostic biomarker of ILD-AA. PMID: 28464801 SP-D also delays FasL-induced death of primary human T cells. SP-D delaying the progression of the extrinsic pathway of apoptosis could have important implications in regulating immune cell homeostasis at mucosal surfaces PMID: 28168327 Trimeric SP-D wildtype recognized larger LPS inner core oligosaccharides with slightly enhanced affinity than smaller compounds suggesting the involvement of stabilizing secondary interactions. PMID: 27350640 rs2819096 in the surfactant protein D (SFTPD) gene was associated with a higher risk of COPD GOLD III + IV. PMID: 27078193 SP-D increases the formation of nuclear and membrane blebs. Inhibition of caspase-8 confirms the effect of SP-D is unique to the caspase-8 pathway. PMID: 29107869 Findings indicate serum pulmonary surfactant protein D (SP-D, SFTPD) level as a potential marker to estimate the efficacy of epidermal growth factor receptor (EGFR)-tyrosine kinase inhibitor (TKIs). PMID: 28745320 Patients with SP-D 11Thr/Thr genotype were more susceptible to acute kidney injury (AKI). Compared with healthy controls, serum SP-D levels at day 1, 3 and 7 were significantly elevated in AKI patients. PMID: 28212617 This review intends to provide a current overview of the genetics, structure and extra-pulmonary functions of the surfactant collectin proteins. PMID: 28351530 Meta-analysis found that serum SP-A/D detection might be useful for differential diagnosis and prediction of survival in patients with idiopathic pulmonary fibrosis. PMID: 28591049 The findings suggest that SP-D inhibits LPS-stimulated production of interleukin-12p40 via the SIRPalpha/ROCK/ERK signaling pathway. PMID: 28641719 Efficient lipopolysaccharide recognition by SP-D requires multiple binding interactions utilizing the three major ligand-binding determinants in the SP-D binding pocket, with Ca-dependent binding of inner-core heptose accompanied by interaction of anhydro-Kdo (4,7-anhydro-3-deoxy-d-manno-oct-2-ulosonic acid) with Arg343 and Asp325. PMID: 26953329 SP-D levels in bronchoalveolar lavage samples were significantly lower in severe asthma compared with healthy controls and mild asthma. Serum SP-D was significantly increased in severe asthma compared with healthy controls and mild asthma. PMID: 26836907 Surfactant protein D levels differed among idiopathic pulmonary fibrosis, pulmonary sarcoidosis and chronic pulmonary obstructive disease. PMID: 27758987 Elevated levels of SP-D are Associated with Idiopathic Pulmonary Fibrosis. PMID: 27293304 Data do not support that pSP-D levels influence or reflect the development of subclinical atherosclerosis. However, the data support that SP-D plays a role in the etiology of atherosclerotic disease development. PMID: 26748346 Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy. PMID: 26603976 Serum SP-D may serve as a convenient medium to distinguish lung infection caused by M. pneumoniae. PMID: 26617840 findings shed new light on the discovery and/or development of a useful biomarker based on glycosylation changes for diagnosing COPD. PMID: 26206179 Quantitative real-time PCR experiments disclosed significantly increased leukocyte NOS2 and SFTPD mRNA levels in hyperglycemic gestational diabetes mellitus patients (P < 0.05). PMID: 26568332 Serum SP-D was not significantly different between patients with connective tissue disease-interstitial lung disease, chronic fibrosing interstitial pneumonia patients and healthy controls. PMID: 26424433 Letter: report higher serum SP-D levels in bird-related hypersensitivity pneumonitis during winter. PMID: 25591150 The SP-D level showed positive correlations with carotid IMT and coronary artery calcification in patients on long-term hemodialysis. PMID: 27012038 SP-D is expressed differently in airways of asthmatics relative to that of non-asthmatics. PMID: 25848896 Sputum and bronchoalveolar lavage fluid SFTPD were significantly higher in patients with severe asthma compared to mild-moderate asthma and healthy controls. PMID: 25728058 We demonstrated for the first time in a Chinese population cohort that genetic polymorphisms of SP-D are not only associated with risk of COPD development, but also related to disease manifestation and that they predict outcomes. PMID: 25376584 In chromium-exposed workers, blood levels of CC16, and CC16/SP-D were lower than in controls. Positive relationships were shown between CC16 or CC16/SP-D and indicators of lung function. PMID: 25851191 In Sjogren's syndrome, high SP-D levels were found in patients with severe glandular involvement, hypergammaglobulinemia, leukopenia, extraglandular manifestations, and positive anti-Ro/La antibodies. PMID: 25362659 Results revealed that higher circulating levels of SP-D are associated with higher mortality risk in critically ill A/H1N1 patients. PMID: 25537934 In idiopathic pleuroparenchymal fibroelastosis SP-D was elevated, while KL-6 was within a normal range. PMID: 24880792 These data suggest that SP-D reduces EGF binding to EGFR through the interaction between the carbohydrate recognition domain of SP-D and N-glycans of EGFR, and downregulates EGF signaling. PMID: 24608429 the multi-faceted role of human SP-D against HIV-1 PMID: 25036364 SFTPD polymorphism is associated with the risk of respiratory outcomes; it may be an essential factor affecting pulmonary adaptation in premature infants PMID: 25015576 Results suggest that Smokers who are carriers of the SFTPD AG and AA polymorphic genotypes may be at a higher risk of developing Chronic obstructive pulmonary disease when compared with wild-type GG genotype carriers. PMID: 24504887 Both mRNA and protein levels of gp340 were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls. PMID: 24121782 In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions. PMID: 24960334 murine expression of human polymorphic variants does not significantly influence the severity of allergic airway inflammation PMID: 24712849 Genetic disposition for low surfactant protein-D was not associated with rheumatoid arthritis but with erosive rheumatoid arthritis by interaction with smoking. PMID: 24264011 SP-D levels were significantly higher in the sub-massive pulmonary embolism group overall. PMID: 25291941 a novel pathway for the immunomodulatory functions of SP-D mediated via binding of its collagenous domains to LAIR-1. PMID: 24585933 Human surfactant protein D alters oxidative stress and HMGA1 expression to induce p53 apoptotic pathway in eosinophil leukemic cell line. PMID: 24391984 Surfactant protein D substitutions at the 325 and 343 positions (D325A+R343V) exhibit markedly increased antiviral activity for seasonal strains of influenza A virus. PMID: 24705721 SFTPD single-nucleotide polymorphisms, rs1923536 and rs721917, and haplotypes, including these single-nucleotide polymorphisms or rs2243539, were inversely associated with expiratory lung function in interaction with smoking. PMID: 24610936 Increases in serum KL-6 and SP-D levels during the first 4 weeks after starting therapy, but not their levels at any one time point, predict poor prognosis in patients with polymyositis/dermatomyositis. PMID: 22983659 serum SP-D, but not SP-A, levels were significantly higher in the German than in the Japanese cohort PMID: 24400879 Lower oligomeric form of surfactant protein D is associated with cystic fibrosis. PMID: 24120837 Lung permeability biomakers [surfactant protein D (SP-D) and Clara cell secretory protein (CC16) in plasma] and forced expiratory volumes and flow were measured in swimmers in indoor swimming pool waters treated with different disinfection methods. PMID: 23874631 In patients with systemic sclerosis-related interstitial lung disease, surfactant protein D was correlated with forced vital capacity. It was not a longterm prognostic indicator. PMID: 23588945

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Surfactant Protein D/SP-D

Recombinant Human Surfactant Protein D/SP-D

Product Overview

Target Details

FAQs