Recombinant Human Sumo-Activating Enzyme Subunit 1 (SAE1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03706P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Sumo-Activating Enzyme Subunit 1 (SAE1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03706P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Sumo-Activating Enzyme Subunit 1 (SAE1) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9UBE0 |
| Target Symbol | SAE1 |
| Synonyms | Activator of SUMO1; AOS1; HSPC140; Sae1; SAE1_HUMAN; Sentrin/SUMO activating protein AOS1; SUA1; SUMO 1 activating enzyme E1 N subunit; SUMO 1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; Ubiquitin like protein SUMO1 activating enzyme; Ubiquitin-like 1-activating enzyme E1A; UBL E1A; UBLE1A |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK |
| Expression Range | 1-346aa |
| Protein Length | Full Length |
| Mol. Weight | 65.4kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2. |
| Subcellular Location | Nucleus. |
| Protein Families | Ubiquitin-activating E1 family |
| Database References | HGNC: 30660 OMIM: 613294 KEGG: hsa:10055 STRING: 9606.ENSP00000270225 UniGene: PMID: 26403403 |
