Recombinant Human Sulfotransferase 1A3 (SULT1A3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08098P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Sulfotransferase 1A3 (SULT1A3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08098P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Sulfotransferase 1A3 (SULT1A3) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0DMM9 |
| Target Symbol | SULT1A3 |
| Synonyms | SULT1A3; STM; Sulfotransferase 1A3; ST1A3; EC 2.8.2.1; Aryl sulfotransferase 1A3/1A4; Catecholamine-sulfating phenol sulfotransferase; HAST3; M-PST; Monoamine-sulfating phenol sulfotransferase; Placental estrogen sulfotransferase; Sulfotransferase 1A3/1A4; Sulfotransferase; monoamine-preferring; Thermolabile phenol sulfotransferase; TL-PST |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
| Expression Range | 1-295aa |
| Protein Length | Full Length |
| Mol. Weight | 61.2kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Sulfotransferase 1 family |
| Database References | |
| Tissue Specificity | Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte. |
