Recombinant Human Store-Operated Calcium Entry-Associated Regulatory Factor (SARAF) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08748P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Store-Operated Calcium Entry-Associated Regulatory Factor (SARAF) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08748P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Store-Operated Calcium Entry-Associated Regulatory Factor (SARAF) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q96BY9 |
| Target Symbol | SARAF |
| Synonyms | FLJ22274; FOAP 7; HBV X transactivated gene 3 protein; HBV X-transactivated gene 3 protein; HBV XAg-transactivated protein 3; HSPC035; MGC8721; Protein FOAP 7; Protein FOAP-7; TMEM 66; Tmem66; TMM66_HUMAN; Transmembrane protein 66; XTP3 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR |
| Expression Range | 195-339aa |
| Protein Length | Cytoplasmic Domain |
| Mol. Weight | 31.5kDa |
| Research Area | Biochemicals |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions. |
| Subcellular Location | Endoplasmic reticulum membrane; Single-pass type I membrane protein. Note=Translocates to the endoplasmic reticulum-plasma membrane (ER-PM) region in a STIM1-dependent manner following cytosolic Ca(2+) elevation.; [Isoform 2]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. |
| Protein Families | SARAF family |
| Database References | HGNC: 28789 OMIM: 614768 KEGG: hsa:51669 STRING: 9606.ENSP00000256255 UniGene: PMID: 29223474 |
