Recombinant Human Stanniocalcin-1 (STC1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-02218P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Stanniocalcin-1 (STC1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-02218P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Stanniocalcin-1 (STC1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P52823
Target Symbol STC1
Synonyms Stanniocalcin 1; Stanniocalcin; Stanniocalcin-1; STC; STC-1; Stc1; STC1_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Expression Range 39-247aa
Protein Length Partial
Mol. Weight 39.6kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia.
Subcellular Location Secreted.
Protein Families Stanniocalcin family
Database References

HGNC: 11373

OMIM: 601185

KEGG: hsa:6781

STRING: 9606.ENSP00000290271

UniGene: PMID: 29857240

  • Data indicate that stanniocalcin 1 (STC1) is a non-canonical NOTCH1 ligand and acts as a crucial regulator of stemness in glioblastoma (GBM). PMID: 29196129
  • these data demonstrated that STC1 can promote cell apoptosis via NF-kappaB phospho-P65 (Ser536) by PI3K/AKT, IkappaBalpha and IKK signaling in cervical cancer cells PMID: 28545028
  • Ssecretory STC1 enhances metastatic potential of hepatocellular carcinomas via JNK signaling. PMID: 28688970
  • Glycolysis from glucose is regulated by hSTC-1, decreasing the adequate supply of glycerol-3-phosphate (G3P) needed for fatty acid esterification and triacylglycerol (TG) storage in brown adipose tissue (BAT). The decrease of TG capacity synthesis from glucose by hSTC-1 compromises the BAT thermogenic capacity. PMID: 28435144
  • Increased STC1 plasma level represents a hallmark of late-onset preeclampsia; STC1 gene variants modulate placental gene expression and maternal hormone levels. PMID: 27603899
  • Latanoprost-induced reduction of intraocular pressure is mediated through the downstream signaling molecule STC-1. When used by itself, STC-1 exhibits ocular hypotensive properties. PMID: 28538979
  • Study demonstrates that STC1 is overexpressed in the prostate carcinoma cell lines and suggests that it promotes prostate carcinoma cell proliferation via cyclin E1/CDK2. PMID: 28350121
  • In the fed state, STC1 increases the incorporation of (14)C from glucose into lipids in the white retroperitoneal adipose tissue (WRAT). STC1 is one of the hormonal factors that control glucose metabolism in WRAT in the fed state. PMID: 27730346
  • STC1 protein is significantly up-regulated in midsecretory endometrial fluid and is dysregulated in eutopic endometrial tissue from women with endometriosis. It is likely regulated by cAMP and may be involved in the pathogenesis of decidualization defects. PMID: 27322879
  • STC1 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  • elevated STC-1 expression is associated with poor clinical outcome in triple-negative breast cancer (TNBC) patients, and STC-1 is directly involved in the invasiveness of TNBC cells PMID: 27461417
  • we demonstrated that aberrant STC1 expression is associated with poor prognosis and stimulates the invasiveness of triplenegative breast cancer cells PMID: 27459971
  • our findings strongly suggest that elevated expression of STC1 protein at the III-IV stage of lung adenocarcinoma promotes tumorigenesis of lung adenocarcinoma and positively associates with the cancer progression, which may be of potential value as tumor marker in clinical tracking lung adenocarcinoma progression. PMID: 26577859
  • Data suggest that stanniocalcin 1 and 2 (STC1, STC2) participate in inhibition of proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) during folliculogenesis. PMID: 26874357
  • STC1 gene expression at diagnosis might be a useful prognostic marker for clinical outcome and monitoring therapeutic response in patients with acute leukemia. PMID: 26547904
  • STC1 blunts bleomycin-induced rise in thrombin protein and activity, diminishes thrombin-induced signaling through PAR1 to ERK, and inhibits bleomycin-induced pneumonitis. PMID: 26640170
  • Data revealed the existence of a moderating effect between Klotho and STC1, where Klotho may inhibit thyroid tumor progression by inhibiting the tumor marker level of STC1. PMID: 26531219
  • High expression levels of stanniocalcin-1 is associated with Hepatocellular Carcinoma. PMID: 26469082
  • Results show that STC1 have an important role in the carbohydrate metabolism regulation, in particular gluconeogenesis from glutamine in the kidney, across the vertebrates. PMID: 26187698
  • Stanniocalcin 1 is expressed in thyroid side population cells and thyroid cancer cells. PMID: 25647164
  • Data show that co-transfection with cDNA encoding stanniocalcin-1 abrogates the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) toward IGF-binding protein 4 (IGFBP-4). PMID: 26195635
  • These findings demonstrate a role for STC1 in metastasis of early stage clear cell renal cell carcinoma. PMID: 25740019
  • Mesenchymal stem cells correct inappropriate epithelial-mesenchyme relation in pulmonary fibrosis using Stc1. PMID: 25373521
  • These results suggested that STC1 may be a valuable biomarker in diagnosing malignant degree of glioma and evaluating prognostic following surgery PMID: 25783529
  • STC1 interferes with CALCRL signaling during osteoblastogenesis via adenylate cyclase inhibition. PMID: 25591908
  • Stanniocalcin 1 downregulation is responsible for sorafenib-induced cardiotoxicity through activated ROS generation. PMID: 25370841
  • Circulating STC1 and STC2 mRNA are potentially useful blood markers for LSCC PMID: 24743310
  • This is the first study to show definitively that STC1 plays an oncogenic role in breast cancer, and indicates that STC1 could be a potential therapeutic target for treatment of breast cancer patients. PMID: 25391215
  • High STC1 expression is associated with glioma. PMID: 24729417
  • was indicated that secreted STC-1 promotes metastatic potential of breast cancer cells via activation of PI3K/AKT PMID: 25056605
  • Stanniocalcin-1 and -2 promote angiogenic sprouting in HUVECs via VEGF/VEGFR2 and angiopoietin signaling pathways. PMID: 23664860
  • An anti-apoptotic protein stanniocalcin-1 (STC-1) can prevent loss of retinal ganglion cells in the rat retina with optic nerve transection PMID: 23667669
  • Data of this experiment showed that higher STC-1 expression during 96 h of preconditioning correlated with more effective MMP protection through the regulation of intracellular level of ROS and cytosolic free Ca2 + and preservation of cell viability. PMID: 23566487
  • STC1 is differentially expressed in the culprit coronary plaques of patients with acute myocardial infarction versus those with stable angina. STC1 may play a role in plaque instability. PMID: 23757035
  • Thus, these results provided evidence that STC1 inhibited cell proliferation and invasion through NF-kappaB p65 activation in cervical cancer. PMID: 23382863
  • Data indicate that the secreted glycoprotein stanniocalcin-1 (STC1) as a mediator of metastasis by PDGF receptor function in the setting of colorectal cancer. PMID: 23243022
  • STC-1 mRNA expression is a reliable marker for detection of DTCs in PB and BM of ESCC patients, and STC-1-positive DTCs may be a promising tool for diagnosis and prognosis assessment in ESCC. PMID: 22537917
  • STC1 is a potentially useful blood marker for predicting biological tumor aggressiveness in patients with gastric cancer PMID: 22889960
  • STC1 activates a novel anti-oxidant pathway in cardiac myocytes through induction of UCP3 PMID: 22693564
  • Stanniocalcin (STC1) plays an important role in functional adaption in pediatric kidney transplantation. PMID: 22588538
  • Overexpression of STC1 was an independent prognostic factor in patients with esophageal cancer who had undergone curative surgery. PMID: 22200953
  • Level of circulating STC1 mRNA in NSCLC was significantly higher than in benign pulmonary disease or healthy volunteers. Higher levels of circulating STC1 mRNA were associated with more advanced tumor stages and histological subtypes. PMID: 21656524
  • The results demonstrate that PKCalpha suppresses the expression of STC1 in breast cancer cells. PMID: 21720730
  • STC-1 could promote angiogenesis in vitro and in vivo, and the angiogenesis was consistent with VEGF expression in vitro. Inhibition of VEGF expression in supernatants with neutralizing antibody markedly abolished angiogenesis induced by STC-1 in vitro. PMID: 21672207
  • Vascular endothelial growth factor-D stimulates endothelial cell VEGF-A, stanniocalcin-1, and neuropilin-2 and has potent angiogenic effects. PMID: 21474827
  • STC1 plays an important role in the early response to mechanical injury by epithelial cells by modulating signaling of extracellular ATP PMID: 20422040
  • STC1 induction by thyroid hormone depends on both TRbeta and PI3K activation. PMID: 20827662
  • High STC1 gene expression is associated with colorectal cancer. PMID: 21273618
  • Human stanniocalcin-1 or -2 expressed in mice reduces bone size and severely inhibits cranial intramembranous bone growth. PMID: 20174869
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed