Recombinant Human Src Kinase-Associated Phosphoprotein 1 (SKAP1) Protein (His-SUMO)

Name: Recombinant Human Src Kinase-Associated Phosphoprotein 1 (SKAP1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10019P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Src Kinase-Associated Phosphoprotein 1 (SKAP1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q86WV1
Target Symbol	SKAP1
Synonyms	pp55; SCAP 1; SCAP1; SKAP 1; SKAP 55; SKAP-55; Skap1; SKAP1_HUMAN; SKAP55 adaptor protein; SRC family associated phosphoprotein 1; Src family-associated phosphoprotein 1; Src kinase associated phosphoprotein 1; SRC kinase associated phosphoprotein 55 kD; Src kinase associated phosphoprotein of 55 kDa; Src kinase-associated phosphoprotein 1; Src kinase-associated phosphoprotein of 55 kDa
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEE
Expression Range	1-358aa
Protein Length	Full Length
Mol. Weight	57.3kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells.
Subcellular Location	Cytoplasm. Nucleus. Cell membrane.
Protein Families	SKAP family
Database References	HGNC: 15605 OMIM: 604969 KEGG: hsa:8631 STRING: 9606.ENSP00000338171 UniGene: PMID: 28052935 SKAP55 dimers stabilize SLP-76 microclusters, couple SLP-76 to the force-generating systems responsible for microcluster movement, and enable adhesion via the TCR by mechanisms independent of RIAM, talin, and beta1 integrins. PMID: 24368808 single-nucleotide polymorphisms in ARRDC3, FLT1, and SKAP1 were significant predictors for survival androgen-deprivation therapy in prostate cancer patients. PMID: 21652578 N-terminal myr-tagged SKAP1 for membrane binding facilitated constitutive RapL membrane and Rap1 binding and effectively substituted for PI3K and TCR ligation in the activation of LFA-1 in T cells. PMID: 21669874 Single nucleotide polymorphism in SKAP1 is associated with ovarian cancer. PMID: 20852632 findings define a T cell receptor "inside-out" pathway via N-SKAP1-C-RapL that regulates T cell adhesion, motility, and arrest times with dendritic cells in lymph nodes. PMID: 20346707 SKAP55 coupled with CD45 positively regulates T-cell receptor-mediated gene transcription. PMID: 11909961 observation that adapter protein SKAP55 formed homodimers through its SH3 domain and SK region PMID: 12171928 SKAP-55 regulates integrin-mediated adhesion and conjugate formation between T cells and antigen-presenting cells PMID: 12652296 stimuli that signal for the stabilization of SKAP55 may play an important role in T cell adhesion and conjugate formation PMID: 15849195 This study reports on a RKXXY294 motif in SKAP-55 that mediates unique ADAP SH3c domain binding; it is necessary for LFA-1-mediated adhesion and cytokine production. PMID: 16461356 These results suggest that SKAP55 modulates signal transduction from the T cell antigen receptor to Ras by binding to RasGRP1. PMID: 17658605 SKAP1 protein as a novel regulator of the metaphase-to-anaphase transition and demonstrates that misregulation of the separase activation results in a reduced fidelity of chromosome segregation and a reduced genomic stability independent of the SAC. PMID: 19667759

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.