Recombinant Human Sparc (SPARC) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08339P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Sparc (SPARC) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08339P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Sparc (SPARC) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P09486
Target Symbol SPARC
Synonyms AA517111; Basement membrane protein 40; Basement-membrane protein 40; BM 40; BM-40; BM40; Cysteine rich protein; hm:zeh0062; MGC128090; OI17; ON; Osteonectin; Secreted acidic cystein rich glycoprotein; Secreted protein acidic and cysteine rich; Secreted protein acidic and rich in cysteine; Secreted protein acidic cysteine rich (osteonectin); Secreted protein acidic cysteine rich; SPARC; SPRC; SPRC_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Expression Range 18-303aa
Protein Length Full Length of Mature Protein
Mol. Weight 59.7kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
Subcellular Location Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane.
Protein Families SPARC family
Database References

HGNC: 11219

OMIM: 182120

KEGG: hsa:6678

STRING: 9606.ENSP00000231061

UniGene: PMID: 29335425

  • Plasma samples from lung cancer patients and healthy heavy-smokers controls were tested for levels of COL11A1 and COL10A1 (n = 57 each) and SPARC (n = 90 each). Higher plasma levels of COL10A1 were detected in patients (p PMID: 30227835
  • The authors have confirmed the presence of SPARC expression in melanoma, Kaposi sarcomas (KS), leiomyosarcomas (LMS) and angiosarcomas (AS) and also detected it for the first time in atypical fibroxanthomas (AFX). PMID: 29660567
  • Results revealed that hypermethylation of the SPARC promoter was the primary mechanism of SPARC downregulation in prostate cancer. SPARC expression was frequently lost during the promoter hypermethylation but could be restored by 5-Aza-Cdr. PMID: 29207175
  • Stromal SPARC expression was a useful biomarker for predicting prognosis in patients with resected pancreatic ductal adenocarcinoma. PMID: 29295776
  • SPARC is closely related to the development of breast cancer and can be used as a tumor marker for breast cancer recurrence. PMID: 29237913
  • SPARC expression was inversely associated with the degree of malignancy and it had a negative correlation with VEGF-C and VEGF-D expression. Results suggest SPARC might function as a tumor suppressor inhibiting angiogenesis and lymphangiogenesis in ovarian cancer by reducing the expression of VEGF-C and VEGF-D. PMID: 29075785
  • SPARC may be involved in gastric cancer metastasis by effecting on tumor microenvironment PMID: 29077165
  • SPARC treatment enhances the epithelial mesenchymal transition signaling pathway via activation of AKT, and exogenous SPARC and tumor expressing SPARC might be associated with tumor progression in head and neck cancers. PMID: 28718842
  • The epicardial adipose tissue expresses the mRNA of osteopontin, osteoprotegerin, and osteonectin genes that have been implicated in the calcification process; such expression is statistically associated with some components of HDL subclasses in coronary artery disease patients. PMID: 28821297
  • detection of SPARC mRNA and protein expression levels may facilitate early diagnosis and prognosis assessment of esophageal squamous cell carcinoma. PMID: 28713937
  • SPARC rs17718347 and rs2347128 single nucleotide polymorphisms are associated with progression-free survival in locally advanced and metastatic pancreatic cancer patients. PMID: 28687963
  • results demonstrated that loss of miR-211 expression and thus uncontrolled SPARC overexpression might drive progression of hepatocellular carcinoma (HCC), which may provide a novel therapeutic strategy for the treatment of HCC. PMID: 27230656
  • Data suggest that plasma SPARC levels may be biomarker for vascular complications among Chinese type 2 diabetic patients; patients in lowest SPARC tertile have increased odds of aortic stiffness but reduced odds of peripheral arterial disease. PMID: 28479157
  • The profiled circulating tumour cells also expressed elevated levels of stem cell markers, and the extracellular matrix protein, SPARC. The expression of SPARC might correspond to an epithelial-mesenchymal transition in pancreatic circulating tumour cells PMID: 28569190
  • Data suggest that both osteonectin and FGF21 levels in serum are associated with early nephropathy in type 2 diabetes, albeit with different patterns; persistent hyperglycemia may inhibit bone formation leading to osteoporosis. (FGF21 = fibroblast growth factor 21) PMID: 27916484
  • These results suggest that increased SPARC expression may be an indicator of greater aggressiveness, and may serve as a prognostic factor for triple-negative breast cancer. PMID: 27421134
  • High expression of SPARC is related to worse prognosis in rectal cancer patients. PMID: 28009327
  • Tumors with stroma-derived SPARC displayed suppressed growth, inhibited angiogenesis and increased lipid accumulation. Based on the described chaperone function of SPARC, authors hypothesized that SPARC binds albumin complexed with fatty acids and transports them to tumors. PMID: 27776337
  • Weekly NAB-paclitaxel might be effective for heavily pretreated non-small-cell lung cancer patients. SPARC expression in tumor stroma cells might be a potential negative predictor of NAB-paclitaxel. PMID: 28304139
  • SPARC-associated signaling pathways are associated with lymphangiogenesis and lymph node metastases of hypopharyngeal cancer. PMID: 29374693
  • Stromal SPARC expression correlated with the prognosis of patients with resectable biliary carcinoma, and its significance was enhanced in patients treated with adjuvant gemcitabine-based chemotherapy. PMID: 28342122
  • Studies revealed that SPARC plays a critical role in regulating bone remodeling and maintaining bone mass and quality. The mechanisms by which SPARC influences bone formation, maintenance, and repair might occur through multiple pathways that include the regulation of procollagen processing and assembly in the bone matrix, crosslinking, mineralization, and/or osteoblast/osteoclast differentiation and activity. [review] PMID: 26851678
  • This study indicates that germline PTCH1 heterozygous mutations play a major role in bone metabolism in patients with NBCCS, in particular in those with PTCH1 protein truncation mutations. SPARC may represent an important downstream modulator of PTCH1 mediation of bone metabolism. PMID: 26890308
  • The SPARC drives pathological responses in non-small cell lung cancer and idiopathic pulmonary fibrosis by promoting microvascular remodelling and excessive deposition of ECM proteins. PMID: 27759879
  • proCOL11A1, fibroblast-activated protein, secreted protein acidic and rich in cysteine, and periostin expression was significantly increased in the intratumoral stroma of pancreatic ductal adenocarcinomas compared to paired non-neoplastic pancreata PMID: 29025374
  • The mRNA and protein levels of SPARC were 5.78-fold higher in cancer tissues compared with the case-matched normal epithelium. High expression levels of SPARC in esophageal squamous cell carcinoma parenchyma were related to lymph node metastasis and poor prognosis (p = 0.049 and p = 0.04). PMID: 28818666
  • SPARC can serve a dual function role as both predictor for prognosis and potentially biomarker for lymph node metastasis in resected pancreatic cancer patients. PMID: 28119265
  • SPARC appears to be an important modulator of the actin cytoskeleton, implicating maintenance of muscular function PMID: 27908613
  • that SPARC-mediated degradation of the extracellular matrix, and its possible association with MMPs, might contribute to progression of phyllodes tumors PMID: 27909812
  • WIN-dependent increase in the level of SPARC plays a critical role in sensitizing osteosarcoma cells to TRAIL action PMID: 26698404
  • high SPARC-expression was a significant predictor of poor OS in HPV-negative OPSCC patients using Kaplan-Meier analysis and the log-rank test PMID: 26523779
  • We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases. PMID: 27069189
  • SPARC levels were not associated with efficacy in patients with MPC. This exploratory analysis does not support making treatment decisions regarding nab-paclitaxel plus gemcitabine or gemcitabine alone in MPC based on SPARC expression. PMID: 26169969
  • CD90 is upregulated in gastric cancer and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein. PMID: 26329007
  • SPARC might be an unfavorable indicator in patients with pancreatic cancer, especially in the stroma.[Review] PMID: 26731428
  • tracheal aspirate SPARC levels predicted development of bronchopulmonary dysplasia or death. PMID: 26656750
  • SPARC is associated with carcinogenesis of oral squamous epithelium. PMID: 25311631
  • Studies indicate that SPARC (secreted protein acidic and rich in cysteine) gene is involved in the development and progression of pancreatic ductal adenocarcinoma (PDAC). PMID: 26335014
  • MLKL upregulation in SPARC overexpressed cells treated with Ara-C, indicates necrosis as a possible cell death process for the SKM-1 cells under these stringent conditions. PMID: 26165695
  • up-regulation of SPARC by oxLDL is independent of Runx2, and it may be mediated by other transcription factors PMID: 26025968
  • Tumor-produced SPARC and VCAM1 are regulators of cancer extravasation. PMID: 25925867
  • miR-29a and miR-29b enhance cell migration and invasion in nasopharyngeal carcinoma progression by regulating SPARC and COL3A1 gene expression. PMID: 25786138
  • SNP1599 differentially regulates osteonectin expression and contributes to variability in bone mass, by a mechanism that may involve differential targeting by miR-433 PMID: 25262637
  • Reduced expression of SPARC in colorectal cancer tissue is associated with poor prognosis and aggressive clinicopathological features. PMID: 26044224
  • Three functional SPARC SNPs are associated with an increased risk of coal workers' pneumoconiosis in a Chinese population. PMID: 25126876
  • reduced expression in the bone marrow biopsy specimen in patients with aplastic anemia PMID: 25032754
  • SPARC promoter methylation as an important factor in the tumorigenesis of gastric carcinomas. PMID: 25516351
  • SCD5 impairs SPARC and cathepsin B secretion in human melanoma cells and intracellular pH acidification. PMID: 25802234
  • High SPARC expression of the primary tumor is associated with a higher chance of achieving a pathological complete remission after TAC or TAC-NX chemotherapy. PMID: 25355716
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed