Recombinant Human Sparc (SPARC) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08339P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Sparc (SPARC) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08339P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Sparc (SPARC) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P09486 |
| Target Symbol | SPARC |
| Synonyms | AA517111; Basement membrane protein 40; Basement-membrane protein 40; BM 40; BM-40; BM40; Cysteine rich protein; hm:zeh0062; MGC128090; OI17; ON; Osteonectin; Secreted acidic cystein rich glycoprotein; Secreted protein acidic and cysteine rich; Secreted protein acidic and rich in cysteine; Secreted protein acidic cysteine rich (osteonectin); Secreted protein acidic cysteine rich; SPARC; SPRC; SPRC_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
| Expression Range | 18-303aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 59.7kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
| Subcellular Location | Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane. |
| Protein Families | SPARC family |
| Database References | HGNC: 11219 OMIM: 182120 KEGG: hsa:6678 STRING: 9606.ENSP00000231061 UniGene: PMID: 29335425 |
