Recombinant Human Soss Complex Subunit B2 (NABP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09929P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Soss Complex Subunit B2 (NABP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09929P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Soss Complex Subunit B2 (NABP1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q96AH0 |
Target Symbol | NABP1 |
Synonyms | FLJ13624; FLJ22833; hSSB2; MGC111163; Nabp1; Nucleic acid-binding protein 1; OBFC2A; Oligonucleotide/oligosaccharide binding fold containing 2A; Oligonucleotide/oligosaccharide binding fold containing protein 2A; Oligonucleotide/oligosaccharide-binding fold-containing protein 2A; Sensor of single strand DNA complex subunit B2; Sensor of single-strand DNA complex subunit B2; Sensor of ssDNA subunit B2; Single stranded DNA binding protein 2; Single-stranded DNA-binding protein 2; SOSB2_HUMAN; SOSS B2; SOSS complex subunit B2; SOSS-B2; SSB2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR |
Expression Range | 1-204aa |
Protein Length | Full Length |
Mol. Weight | 38.4kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. |
Subcellular Location | Nucleus. Note=Localizes to nuclear foci following DNA damage. |
Protein Families | SOSS-B family, SOSS-B2 subfamily |
Database References | HGNC: 26232 OMIM: 612103 KEGG: hsa:64859 STRING: 9606.ENSP00000403683 UniGene: PMID: 27793000 |