Recombinant Human Somatostatin Receptor Type 5 (SSTR5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06929P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Somatostatin Receptor Type 5 (SSTR5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06929P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Somatostatin Receptor Type 5 (SSTR5) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P35346 |
Target Symbol | SSTR5 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | C-10His |
Target Protein Sequence | LSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL |
Expression Range | 307-364aa |
Protein Length | Partial |
Mol. Weight | 8.0 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 1 family |
Database References | HGNC: 11334 OMIM: 182455 KEGG: hsa:6755 STRING: 9606.ENSP00000293897 UniGene: PMID: 27507050 |