Recombinant Human Somatostatin Receptor Type 5 (SSTR5) Protein (His)

Name: Recombinant Human Somatostatin Receptor Type 5 (SSTR5) Protein (His)
Brand: Beta LifeScience
SKU: BLC-06929P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Somatostatin Receptor Type 5 (SSTR5) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P35346
Target Symbol	SSTR5
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-10His
Target Protein Sequence	LSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
Expression Range	307-364aa
Protein Length	Partial
Mol. Weight	8.0 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 11334 OMIM: 182455 KEGG: hsa:6755 STRING: 9606.ENSP00000293897 UniGene: PMID: 27507050 sst5TMD4 is overexpressed in PCa, especially in those patients with a worse prognosis, and plays an important pathophysiologic role in PCa, which suggesting its potential as a biomarker and/or therapeutic target PMID: 28705809 In cotransfected HEK-293 cells, SSTR5 and CB1R existed in a constitutive heteromeric complex under basal condition, which was disrupted upon agonist treatments. Furthermore, concurrent receptor activation led to preferential formation of SSTR5 homodimer and dissociation of CB1R homodimer. PMID: 27984180 A truncated splice variant of the somatostatin receptor subtype 5, is associated to features of increased aggressiveness in pancreatic neuroendocrine tumors. PMID: 26673010 SSTR5 was the predominantly expressed receptor subtype in the cytoplasm of all GH-secreting adenomas tested, regardless of whether they came from octreotide-naive, octreotide-responsive, or octreotide-resistant patients. SSTR5 mRNA predominance was significant only in octreotide treated patients. Its expression was not correlated with baseline or post-octreotide GH or IGF-1 levels or tumor volume. PMID: 25008035 This is the first evidence indicating that sst5TMD4 is expressed in human medullary thyroid carcinoma cells, where it associates with more aggressive behavior, suggesting that sst5TMD4 might play a functionally relevant role. PMID: 25854304 A truncated sst5-variant (sst5TMD4) can influence the secretory response of somatotropinomas to somatostatin analogues-therapy. PMID: 25637790 SSTR5 protein is overexpressed in poorly differentiated thyroid cancer and may be involved in the lack of response to somatostatin analogue treatment. PMID: 24465589 High SSTR5 expression is associated with gallbladder cancer. PMID: 23991955 agonist-selective phosphorylation of carboxyl-terminal Threonine 333 of Sst5, is reported. PMID: 23418396 Report down-regulation of SSTR-5 expression in operable hepatocellular carcinomas. PMID: 22640914 Except for SSTR5, all SSTRs showed a tendency toward decreased expression in well-to poorly differentiated neuroendocrine carcinoma of the lung. PMID: 22770972 Determination of the expression of SSTR5 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas. PMID: 22419713 The rabbit monoclonal antibodies UMB-4 and UMB-1 will facilitate the assessment of the somatostatin receptor status of human tumors during routine histopathological examinations. PMID: 21952553 SSTR5 P335L is a hypofunctional protein with a potentially harmful effect on function, as well as potential latent effect, and therefore it could affect the clinical response to somatostatin analog therapy for patients with pancreatic cancer. PMID: 21249361 Our results demonstrate a previously undetected strong association of two SSTR5 single nucleotide polymorphisms with acromegaly PMID: 21810856 ZDHHC5 and SSTR5 are colocalized at the plasma membrane and coexpression of ZDHHC5 increased palmitoylation of SSTR5 whereas knock-down of endogenous ZDHHC5 by siRNAs decreased it. PMID: 21820437 differential gene expression profiles revealed more abundant mRNA expression in ectopic ACTH syndrome than in Cushing disease of SSTR-5 PMID: 21383526 data suggest that SSTR5 genetic variants play a role in pancreatic cancer development and progression PMID: 21692047 demonstrate that cells transfected with SSTR1 or SSTR1/5 negatively regulates EGF mediated effects attributed to the inhibition of EGFR phosphorylation. PMID: 21419811 The heterodimerization of somatostatin receptor-5 not only indicate the receptor's specificity of interaction but also provide new insight to understand the molecular mechanism in regulation of signaling pathway in receptor specific manner. PMID: 21238583 These data indicate that the activation and/or overexpression of SST receptors along with the inhibition of EGFR will serve as an important therapeutic approach in the treatment of ErbB-positive tumors. PMID: 21190959 Common genetic variation in the IGF1 and SSTR5 genes seems to influence circulating IGF-I levels PMID: 20810604 This study demonstrated negative immunoreactivity for SSTR-5 in the adenomatous tissue. PMID: 19894022 importance of Asn13 and/or Asn26 residues in the agonist-specific signalling of hSSTR5 PMID: 20207824 Potential role of SSTR5 in the response of some tumors to somatostatin receptors. PMID: 20233783 SSTR5 and CCR7 have a role in Crohn's disease pathogenesis PMID: 20150960 identified an upstream promoter of the somatostatin receptor 5 gene with tissue-specific activity PMID: 12072395 the SSTR5 gene is involved in the etiology of bipolar affective disorder or may exist in linkage disequilibrium with a susceptibility gene close to SSTR5. PMID: 12192619 Results do not suggest the SSTR5 gene as a susceptibility gene for autism PMID: 12898583 activation of hSSTR5 but not hSSTR1 is necessary for heterodimeric assembly PMID: 15247250 role for SSTR5 t-461c and c1004t alleles in influencing GH and IGF-I levels in patients with acromegaly, whereas SSTR2 and SSTR5 variants seem to have a minor role in determining the responsiveness to somatostatin analogs PMID: 15914528 intracellular sorting of the somatostatin receptor subtype 5 is regulated by interactions with PDZ domain proteins PIST/GOPC and PDZK1 PMID: 16012170 Results suggest that the expression pattern of dopamine receptor 2 and somatostatin receptor 5 may influence the effects of SRIF analogs in growth hormone-secreting pituitary adenomas. PMID: 16216913 The expression of SSTR5 in TSHoma may be a useful marker for predicting the outcome of octreotide therapy. PMID: 17159301 The majority of all benign, premalignant and malignant laryngeal specimens expressed moderate to high levels of expression of SSTR5. PMID: 18066572 Immunohistochemistry stufy of SSTR5 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells showed a weak positivity in the cytoplasm. PMID: 18936524 SSTR5 mRNA levels in Cushing disease were greater than silent corticotroph adenoma (SCA) but did not differ between non-functioning pituitary tumor and SCA. PMID: 19318729 investigation of the role of BBXXB and DRY motifs of SST5 in the transduction of intracellular signals involved in the regulation of GH secretion and cell proliferation PMID: 19342453 The existence of two previously unidentified sst5 spliced variants with distinct distribution in normal tissues and pituitary tumors. PMID: 19401364 Genetic variation in the SSTR5 gene and, particularly, the rs4988483 single nucleotide polymorphism influence circulating IGFI and IGFBP3 hormone levels with no measurable effect on prostate cancer risk. PMID: 19423539

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.