Recombinant Human Somatostatin Receptor Type 2 (SSTR2) Protein (His), Active

Name: Recombinant Human Somatostatin Receptor Type 2 (SSTR2) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05753P
Availability: InStock

this product is detected by Mouse anti-6*His monoclonal antibody.

Activity Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/ml can bind Anti-SSTR2 recombinant antibody , the EC 50 is 58.13-81.28 ng/mL. Biological Activity Assay

Blocking experiment on Anti-SSTR2 antibody between Human SSTR2-VLPs protein and CT26/Human SSTR2 Stable Cells by Flow cytometry. Biological Activity Assay

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Somatostatin Receptor Type 2 (SSTR2) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	1. Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/mL can bind Anti-SSTR2 recombinant antibody , the EC 50 is 58.13-81.28 ng/mL. 2. Blocking experiment on Anti-SSTR2 antibody between Human SSTR2-VLPs protein and CT26/Human SSTR2 Stable Cells by Flow cytometry.
Uniprotkb	P30874
Target Symbol	SSTR2
Synonyms	(SS-2-R)(SS2-R)(SS2R)(SRIF-1)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Target Protein Sequence	MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Expression Range	1-369aa
Protein Length	Full Length
Mol. Weight	42.5 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cytoplasm. Note=Located mainly at the cell surface under basal conditions. Agonist stimulation results in internalization to the cytoplasm.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 11331 OMIM: 182452 KEGG: hsa:6752 STRING: 9606.ENSP00000350198 UniGene: PMID: 28467778 The results of this study showed the SSTR2 expression was lower in patients pretreated with LA-SSA/PEGV compared to the drug-naive acromegalic patients. PMID: 27455094 IHC of SSTR subtypes in the different cohorts showed SSTR2 staining intensity scores higher than SSTR5 in TSHoma, acromegaly and prolactinoma, whereas the expression of SSTR5 was stronger than SSTR2 in corticotropinoma and NFPA. PMID: 28434012 SSTR2 was significantly hypermethylated in colorectal cancer tissues when compared with adjacent normal colorectal tissues. PMID: 28782576 This study investigated the presence of progenitor/stem cells in non-functioning pituitary tumors (NFPTs) and tested the efficacy of dopamine receptor type 2 (DRD2) and somatostatin receptor type 2 (SSTR2) agonists to inhibit in vitro proliferation PMID: 28120505 expression of MDM2, somatostatin receptor 2A, and PD-L1 in follicular dendritic cell sarcoma PMID: 27402219 Combination treatment increased both SSTR2 and SSTR5 mRNA and protein levels in DU-145 cells. The data suggest that this combination therapy may be a good candidate for patients with advanced metastatic Prostate cancer (PCa) do not respond to androgen deprivation. PMID: 26531719 although the limited number of cases with adequate term follow-up, SSTR-2A expression could be a prognostic factor and somatostatin analogs therapeutic candidate for SmCCs of the bladder as these tumors show high percentage of SSTR-2A expression PMID: 25906124 SSTR2 expression was tested in GH-secreting adenomas from 60 patients with acromegaly who had undergone pituitary surgery, 36 of whom had received octreotide with varying levels of response. Its expression was not correlated with baseline or post-octreotide GH or IGF-1 levels or tumor volume. PMID: 25008035 Filamin-A is required to mediate SSTR2 effects in pancreatic neuroendocrine tumours PMID: 26733502 SSTR2 promoter hypermethylation might be associated with the risk and progression of laryngeal squamous cell carcinoma in males. PMID: 26796520 VPA was observed to stimulate the expression of somatostatin receptor type 2 (SSTR2). PMID: 26211366 Results show that histological subtyping of pituitary tumor correlated with SSTR2, E cadherin and p27kip protein levels and these may serve as useful biomarkers for prognosis. PMID: 26391562 there is an elevation in CXCR4 and a decrease in SSTR2A expression with increasing malignancy in gastroenteropancreatic neuroendocrine neoplasms PMID: 26259237 mir-185 regulates the expression of SSTR2 in GH-secreting pituitary adenoma. The staining intensity of SSTR2 is stronger in adenoma samples than controls. PMID: 26036598 Data indicate that somatostatin receptor scintigraphy (SRS) and immunohistochemical results for somatostatin and dopamine receptors sstr2, sstr3, sstr5 and D2R were compared in neuroendocrine neoplasms tissues. PMID: 25808161 CD56 marker is a useful alternative that is comparable to SSTR2A for the diagnosis of phosphaturic mesenchymal tumors. PMID: 26339384 The number of SSTR-2-expressing cells was significantly smaller in the patients with Crohn's disease than that in those with the unchanged mucosa and in those with indeterminate (unclassified) colitis. PMID: 26978232 In pancreatic neuroendocrine tumors, the primary tumor and metastases differ significantly in their SSTR2A expression. PMID: 25872131 Study demonstrates the first evidence of SST2R expression and somatostatin receptor scintigraphy positivity in pancreatic serous cystadenomas. PMID: 25872132 Somatostatin receptors were expressed in a high proportion of merkel cell carcinomas, although expression was heterogeneous between tumours and was not associated with disease severity. PMID: 25765179 SSTR2 gene expression was dysregulated in the anterior cingulate of bipolar patients. PMID: 26238605 Low SSTR2 expression is associated with pancreatic cancer. PMID: 25890201 e hSSTr2 gene can act as not only a reporter gene for in vivo imaging, but also a therapeutic gene for local radionuclide therapy. PMID: 25879040 Somatostatin type 2 receptor, a clinically crucial molecular target, shows variable and unpredictable expression in neuroendocrine neoplasms irrespective of tumor grade. PMID: 25591947 This study indicated that SSTR2 may be associated with the selective vulnerability of the noradrenergic system in Alzheimer's disease. PMID: 25676386 sST2 is proposed as a biomarker for progressive vascular fibrosis, and the involvement of sST2 in the pathogenesis of limited cutaneous systemic sclerosis may be exploited therapeutically. PMID: 26095613 The expression of VEGF and SSTR2 were associated with progression and prognosis of gastric cancer. PMID: 26158180 SSTR2 and SSTR5 protein levels were induced as compared to any agent alone. PMID: 25925002 SSTR 5 was shown to be the main receptor subtype in the analysed differentiated or anaplastic thyroid malignancies, whereas SSTR 2 was found only in a small percentage. PMID: 24967740 SSTR2A and SSTR3 are more likely to be expressed in SDH-deficient pheochromocytomas/paragangliomas compared with tumors demonstrating normal SDHB staining pattern. PMID: 25554089 Relationships between SSTR2A and breast or prostate cancer showed low concordance between CpGs methylation grade and cancer. PMID: 25635370 SSTR2 expression seems an important factor in the pathogenesis of prostate cancer PMID: 25010045 agonist-selective sst2 receptor internalization is regulated by multi-site phosphorylation of its carboxyl-terminal tail. PMID: 24565897 Filamin A is involved in SST2 stabilization and signaling in tumoral somatotrophs, playing both a structural and functional role. PMID: 24828612 SSTR2 is overexpressed in gastric and duodenal neuroendocrine tumors PMID: 24565507 We genotyped two single nucleotide polymorphisms (SNPs) in genes of importance for respiratory control: P2RY1 (adenosine diphosphate/adenosine triphosphate receptor) and SSTR2 (somatostatin receptor). PMID: 23828624 ZAC1 and SSTR2 are down-regulated in non-functioning pituitary adenomas but not in somatotropinomas. PMID: 24098585 Whereas sst2 receptors might play a primary role in the differentiation and regulation of TSH, LH, and FSH cells, sst5 receptors appear to be mainly involved in GH regulation from birth onward PMID: 24189142 The analyses of this study demonstrated specific upregulation of sst 2 mRNA in medulloblastoma PMID: 23677175 We studied the expression of SSTR(2A) and SSTR(5) with new procedures in 108 pituitary tumors PMID: 24182563 Somatostatin receptor-2 positivity, either focal or diffuse, does not seem to predict prognosis in gastroenteropancreatic neuroendocrine tumors. PMID: 23794313 Because of its diffuse strong expression and widespread availability, immunohistochemistry for SSTR2A is useful to confirm the diagnosis of phosphaturic mesenchymal tumors in an appropriate setting particularly if material is limited. PMID: 24060005 mRNA levels of SSTR2a, SSTR3 and SSTR5 in neuroendocrine lung cancer affected patients, were determined. PMID: 21503779 Low somatostatin receptor subtype 2, but not dopamine receptor subtype 2 expression is associated with the lack of biochemical response of somatotropinomas to treatment with somatostatin analogs PMID: 22472799 Results suggest that targeting adenoviral vectors to sstr2A could provide a new strategy for the efficient transfer of genes to glioblastoma cells. PMID: 22592599 Report down-regulation of SSTR-2 expression in operable hepatocellular carcinomas. PMID: 22640914 Data suggest that somatostatin-14 inhibits secretion from alpha and beta pancreatic cells by activating GIRK (G protein-coupled inwardly-rectifying potassium channel) and inhibiting exocytosis; these effects are mediated by SSTR2 in both cell types. PMID: 22932785 Mean cortical SSTR2 mRNA levels were significantly (19%) lower in the subjects with schizophrenia compared to controls. PMID: 21215273 Data show that the aspartic acid changes at position 89 to either Ala, Leu, or Arg generated mutant somatostatin receptor subtype 2 (SSTR2) with varying expression profiles and a complete inability to bind somatostatin-14 (SST). PMID: 22495673

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.