Recombinant Human Solute Carrier Family 2, Facilitated Glucose Transporter Member 1 (SLC2A1) Protein (His&Myc)

Name: Recombinant Human Solute Carrier Family 2, Facilitated Glucose Transporter Member 1 (SLC2A1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-04815P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Solute Carrier Family 2, Facilitated Glucose Transporter Member 1 (SLC2A1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P11166
Target Symbol	SLC2A1
Synonyms	Choreoathetosis/spasticity episodic (paroxysmal choreoathetosis/spasticity); CSE; DYT17; DYT18; DYT9; EIG12; erythrocyte/brain; Erythrocyte/hepatoma glucose transporter; facilitated glucose transporter member 1; Glucose transporter 1; Glucose transporter type 1; Glucose transporter type 1, erythrocyte/brain; GLUT ; GLUT-1; GLUT1; GLUT1DS; GLUTB; GT1; GTG1; Gtg3; GTR1_HUMAN; HepG2 glucose transporter; HTLVR; Human T cell leukemia virus (I and II) receptor; MGC141895; MGC141896; PED; RATGTG1; Receptor for HTLV 1 and HTLV 2; SLC2A1; Solute carrier family 2 (facilitated glucose transporter), member 1; Solute carrier family 2; Solute carrier family 2, facilitated glucose transporter member 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP
Expression Range	207-271aa
Protein Length	partial
Mol. Weight	15.2 kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Melanosome. Photoreceptor inner segment.
Protein Families	Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
Database References	HGNC: 11005 OMIM: 138140 KEGG: hsa:6513 STRING: 9606.ENSP00000416293 UniGene: PMID: 30353771 These findings promote development of metabolic-based cancer detection technologies, and suggest that 2GF-GNPs may enable specific cancer detection in a wide range of tumors characterized by high GLUT-1 expression PMID: 30028251 Kazakh and Han patients with esophageal squamous cell carcinoma with Glut1 c-myc co-expression had poorer prognosis. PMID: 29629851 miR-328 expression is reduced in colon cancer patients and thus inversely correlates with the classically reported upregulated SLC2A1/GLUT1 expression in tumors. PMID: 29374351 Glucose transporter-1 could play a role not only in the onset of psoriasis but also in the progression and severity of the disease. It may participate in the pathogenesis of psoriasis through the facilitation of epidermal hyperproliferation, inflammation, and angiogenesis. PMID: 29797802 Data suggest that GLUT1 functions as tetramer of adjacent dimers of allosteric, alternating access transporters in which (a) cis-allostery is mediated by intra-subunit interaction and (b) trans-allostery requires inter-subunit interaction. Endofacial (vs exofacial) cis-allostery obtains when affinity of un-liganded e1 (endofacial) GLUT1 subunit in one dimer is increased by occupancy of e1 GLUT1 subunit of adjacent dimer. PMID: 29066623 Results show that GLUT1 is sensitive and specific marker for colorectal cancer (CRC). It is overexpressed in young age patients, poor performance status, and stage IV patients. Although this was not statistically significant, GLUT 1 showed higher expression level in patients with lesser survival. PMID: 29205188 GLUT1 ectopic overexpression makes PCa cells more resistant to glucose deprivation and oxidative stress-induced cell death. Under glucose deprivation, GLUT1 overexpressing PCa cells sustains mitochondrial SOD2 activity, compromised after glucose removal, and significantly increases reduced glutathione (GSH) PMID: 29684818 Results confirm the positive expression of Glut1 in colorectal neoplasm (CRC) and its involvement in proliferation and cell survival of cancer cells. Its silencing inhibits the proliferation and promoted apoptosis of CRC cells by inactivating TGF-beta/PI3K-AKT-mTOR signaling pathway. PMID: 28884839 p-ERK-mediated phosphorylation and stabilization of JMJD2B during glucose deprivation contributes to its role in glucose uptake and cell viability, which may be modulated through epigenetically upregulation of GLUT1 in colon cancer cells. PMID: 28945223 work characterized the clustering distribution of GLUT1 and linked its spatial structural organization to the functions, which would provide insights into the activation mechanism of the transporter. PMID: 29915035 This study present the results from the molecular genetics study of the SLC2A1 gene in Bulgarian patients with different forms of genetic generalized epilepsy having emerged in childhood. PMID: 29223885 Expression of SLC5A5 mRNA was negatively correlated with SLC2A1 mRNA. This finding provides a molecular basis for the management of PTC with negative WBS using F-FDG PET scans. In addition, higher expression of SLC5A5 mRNA was associated with less PTC [papillary thyroid cancer] recurrence, but not with deaths. PMID: 29978611 GLUT-1 in nasopharyngeal carcinoma and its clinical significance PMID: 29164572 YAP1 interacted with TEAD1, exerted their transcriptional control of the functional target, glucose transporter 1 (Glut1). PMID: 28892790 experiments mainly reveal that the CREB1 could affect glucose transport in glioma cells by regulating the expression of GLUT1, which controlled the metabolism of glioma and affected the progression of glioma. PMID: 28646353 These data provide new insights into the physiological relevance of GLUT1 multimerization as well as a new variant of bioluminescent Forster resonance energy transfer assay that is useful for measuring the interactions among other cell membrane proteins in live cells PMID: 27357903 Study demonstrated that the high mRNA level of both MCT1 and GLUT1 correlated with poor prognosis, high- Fuhrman grade clear-cell renal cell carcinoma and metabolic reprogramming. PMID: 29481555 GLUT1 and MCT1 membrane overexpression was significantly higher in Papillary Renal Cell carcinoma PMID: 28028797 the TT genotype in XbaI G>T SNP and CC genotype of HaeIII T>C SNP may have protective effect in the carcinogenesis process of UCC. In the XbaI G>T SNP, the GG genotype of was positively related to tumor proliferation, glucose metabolism, tumor grade and stage. PMID: 28524154 HOTAIR promoted glycolysis by upregulating glucose transporter isoform 1 (GLUT1) and activating mammalian target of rapamycin (mTOR) signaling. PMID: 28731193 In preeclampsia, placental GLUT1 expression and function are down-regulated at the apical plasma membrane of the syncytiotrophoblast. PMID: 28623979 High glut1 expression is associated with Pancreatic Cancer. PMID: 28180987 Study confirms the high expression of Glut-1 not only in endometrioid carcinomas but also in other carcinomas of endometrium including clear cell and serous types. Glut-1 expression can be used as a surrogate marker in differential diagnosis between hyperplasia with and without atypia. PMID: 28381136 This systematic review and meta-analysis indicated that the GLUT1 may serve as an ideal prognostic biomarker in various cancers. PMID: 28498810 This study did not detect any pathogenic mutations in SLC2A1 in the patient with focal epilepsy. PMID: 28419980 Taken together, our study provides a new perspective of miR-148b in gastric cancer (GC) development through inhibiting glycolysis in GC cells , directly targeting glucose transporter SLC2A1. PMID: 28440026 Data suggest that plasma glycation with erythrocyte membrane modification is associated with oxidative stress, GLUT1 expression, and erythrocyte fragility in patients with type 2 diabetes; such glycation may further contribute to progression of diabetic vascular complications. PMID: 27884659 FOXM1 bound directly to the GLUT1 and HK2 promoter regions and regulated the promoter activities and the expression of the genes at the transcriptional level. This reveals a novel mechanism by which glucose metabolism is regulated by FOXM1. PMID: 27351131 Whereas, Glut1-mediated glucose uptake also requires mTORC2 phosphorylation of the hydrophobic domain, demonstrating both phosphorylation-dependent and independent roles of the hydrophobic domain in regulating glucose uptake. PMID: 28589878 The levels of GLUT1 and GLUT3, the major brain glucose transporters, are decreased, especially in the cerebral cortex in patient with Alzheimer disease. PMID: 27858715 High levels of GLUT1 are associated with Lung Adenocarcinoma. PMID: 29374742 Glucose transporter type 1 deficiency syndrome is the result of impaired glucose transport into the brain. Patients with glucose transporter type 1 syndrome may present with infantile seizures, developmental delay, acquired microcephaly, spasticity and ataxia. PMID: 28443597 The results demonstrated the high frequency of C allele of SLC2A1 HaeIII in Kurdish patients with diabetic nephropathy. It was also found that this polymorphism is a significant risk factor for diabetic nephropathy. The effect of this polymorphism on clinical and laboratory characteristics of diabetic nephropathy patients was significant. PMID: 26337659 Expression of GLUT1 is stimulated by hyperglycemia and low oxygen supply, and this overexpression was associated with increased activity of GLUT1 in the cell membrane that contributes to the impairment of the RPE secretory function of PEDF. PMID: 27440994 A heterozygous SLC2A1 mutation in the severely affected child was inherited from his less severely affected mother who was mosaic for the mutation PMID: 28124377 UCP2 stimulates hnRNPA2/B1, GLUT1 and PKM2 expression and sensitizes pancreatic cancer cells to glycolysis inhibition. PMID: 27989750 ablation of Glut1 attenuated apoptosis and increased drug resistance via upregulation of p-Akt/p-GSK-3beta (Ser9)/beta-catenin/survivin. PMID: 28803837 Data show that SALL4 promotes the expression of Glut1 and open chromatin through a HP1alpha-dependent mechanism. PMID: 28759035 Results show that PPARalpha directly targeted the consensus PPRE motif of Glut1 promoter region resulting in Glut1 transcription repression leding to decreased influx of glucose in cancer cells. PMID: 27918085 Strong GLUT1 staining was inversely associated with circulating levels of fasting glucose in high grade serous ovarian cancer. PMID: 28542798 Metabolically active CD4+ T cells expressing Glut1 and OX40 preferentially harbor HIV during in vitro infection. PMID: 28892135 SLC2A1/GLUT1 is expressed late in the adenoma-carcinoma sequence during carcinogenesis in intraductal papillary mucinous neoplasms of the pancreas. PMID: 28412205 Paraoxonase 2 facilitates pancreatic ductal cancer growth and metastasis by stimulating GLUT1-mediated glucose transport. PMID: 28803777 Data show that Prima-1 kills hypoxic wt p53 KRAS-mutant cells resistant to 3-bromopyruvate (3-BrPA), partly by decreasing GLUT-1 expression. PMID: 27863474 A de novo 5'-UTR variant in SLC2A1, generating a novel translation initiation codon, severely compromising SLC2A1 function was identified in a GLUT1 deficiency syndrome patient. PMID: 28378819 High GLUT1 expression is associated with metastasis and epithelial-mesenchymal transition in hepatocellular carcinoma. PMID: 28429188 High GLUT-1 expression predicted shorter overall survival (OS) in patients with pancreatic cancer, and was was associated with a tumor size of >2 cm and presence of lymph node metastasis. PMID: 28178665 detected significantly reduced GLUT1 expression only on red blood cells from patients with GLUT1-Deficiency Syndrome. PMID: 28556183 GLUT-1(+) specimens were classified as true infantile hemangioma (IH) and GLUT-1(-) specimens were reclassified as pyogenic granulomas and vascular malformations based on their histopathological features. PMID: 28545938

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.