Recombinant Human Sodium/Potassium-Transporting Atpase Subunit Gamma (FXYD2) Protein (GST)

Name: Recombinant Human Sodium/Potassium-Transporting Atpase Subunit Gamma (FXYD2) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08150P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Sodium/Potassium-Transporting Atpase Subunit Gamma (FXYD2) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P54710
Target Symbol	FXYD2
Synonyms	FXYD2; ATP1C; ATP1G1; Sodium/potassium-transporting ATPase subunit gamma; Na(+)/K(+) ATPase subunit gamma; FXYD domain-containing ion transport regulator 2; Sodium pump gamma chain
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Expression Range	1-64aa
Protein Length	Full Length of Isoform 2
Mol. Weight	34.4kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
Subcellular Location	Membrane; Single-pass type III membrane protein.
Protein Families	FXYD family
Database References	HGNC: 4026 OMIM: 154020 KEGG: hsa:486 STRING: 9606.ENSP00000292079 UniGene: Hs.731865
Associated Diseases	Hypomagnesemia 2 (HOMG2)
Tissue Specificity	Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.

Gene Functions References

FXYD2 is functionally upregulated in ovarian clear cell carcinoma and may serve as a promising prognostic biomarker and therapeutic target of cardiac glycosides in OCCC PMID: 26910837
Recurrent FXYD2 p.Gly41Arg mutation is associated with isolated dominant hypomagnesaemia. PMID: 25765846
FXYD2b could regulate the Na,K-ATPase by modulating the effective membrane surface electrostatics near the ion binding sites of the pump. PMID: 24794573
our findings suggested that FXYD2c played a role in regulation of NKA activity by enhancing the expression of NKA in HK-2 cells upon hypertonic challenge. PMID: 24258619
PCBD1 (dimerization cofactor of HNF-1alpha) is coactivator of the HNF1B-mediated transcription necessary for fine tuning ATPase Na+/K+ transporting gamma 1 polypeptide (FXYD2) transcription in the distal convoluted tubule. PMID: 24204001
This is the first report demonstrating the potential utility of FXYD2 immunohistochemistry in the diagnosis of chromophobe renal cell carcinoma PMID: 23196795
findings confirm the presence of an FXYD2 peptide in the crab gill Na,K-ATPase and demonstrate that this peptide plays an important role in regulating enzyme activity PMID: 22588134
wild type HNF1B specifically induces FXYD2A transcription whereas all HNF1B mutants partially prevented it. PMID: 21130072
Datab propose human FXYD2gammaa as a novel beta cell-specific biomarker. PMID: 20379810
Study reveals, in various human tissues, the specific expression of FXYD2, which may associate with Na, K-ATPase in selected cell types and modulate its catalytic properties. PMID: 19879113
the TM domain of FYXD2 effects the shift in apparent Na+ affinity PMID: 12907667
Activity of GLAST directs FXYD2 protein/gamma subunit to the cell surface, that leads to the activation of the astroglial sodium pump. PMID: 17316900
structures of the FXYD proteins (with emphasis on 1-4), as well as their dynamics and their associations with the lipid PMID: 18000745
results suggest that FXYD2 can mediate basolateral extrusion of magnesium from cultured renal epithelial cells and provide new insights into the understanding of the possible physiological roles of FXYD2 wild-type and mutant proteins. PMID: 18448590
Expression in transfectants reduces Na+ and K+ affinity of Na,K-ATPase. Endogenous expression in certain nephron segments correlates with low Na+ affinity in Na,K-ATPase. PMID: 10559186

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.