Recombinant Human Sodium/Iodide Cotransporter (SLC5A5) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00570P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Sodium/Iodide Cotransporter (SLC5A5) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00570P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Sodium/Iodide Cotransporter (SLC5A5) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q92911
Target Symbol SLC5A5
Synonyms (Na(+)(-)(Natrium iodide transporter)(Sodium-iodide symporter)(Na(+)(-)(Solute carrier family 5 member 5)
Species Homo sapiens (Human)
Expression System E.coli
Tag C-6His
Target Protein Sequence SCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
Expression Range 547-643aa
Protein Length Partial
Mol. Weight 17.4 kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Mediates iodide uptake in the thyroid gland.
Subcellular Location Membrane; Multi-pass membrane protein.
Protein Families Sodium:solute symporter (SSF) (TC 2.A.21) family
Database References

HGNC: 11040

OMIM: 274400

KEGG: hsa:6528

STRING: 9606.ENSP00000222248

UniGene: PMID: 29131623

  • The expression of NIS differs insignificantly in gastric tissue of obese and control individuals. PMID: 29631680
  • NIS localization in the follicular lumen in nodular goiter patients PMID: 28190186
  • Results show transgene induction under hypoxia in tumor cell spheroid models, or radioiodide uptake using sodium iodide symporter (NIS). PMID: 27458162
  • Data suggest iodination of TG is involved in regulation of NIS expression in thyroid follicle via TSH/TSHR signaling; NIS expression and PKA activity are up-regulated by lowly iodinated TG; NIS expression is down-regulated and PKC activity up-regulated by highly iodinated TG. (TG, thyroglobulin; NIS, sodium/iodide symporter; PK, protein kinase; TSH, thyroid-stimulating hormone; TSHR, thyroid-stimulating hormone receptor) PMID: 28396984
  • Data indicate that although fewer than 25% of cells expressed Na+/I- symporter (NIS), combining131I- with gemcitabine (GEMGEM/131I)- caused dramatic tumor regression in NIS-transduced breast cancer brain metastases (BCBMs). PMID: 27363025
  • Experiments in whole cells demonstrated that these four residues participate in transport by NIS: mutations at these positions result in proteins that, although expressed at the plasma membrane, transport little or no I(-) These residues are conserved throughout the entire SLC5 family, to which NIS belongs, suggesting that they serve a similar function in the other transporters PMID: 27562170
  • Study brings out molecular evidence showing that NIS is a direct target of wild-type p53 and its activation upon Doxorubicin drug exposure results in suppression of NIS expression and function in breast cancer cells. PMID: 28528452
  • radiotracer accumulation in transfected cells correlated with the induction of hNIS and with the expression of miRNAs detected by real time PCR. PMID: 28493972
  • Results indicate that Na+/I- symporter (NIS) can be used as an objective used as an objective criterion for determining the sensitivity of luminal B and basal breast cancer (BC)subtypes to neoadjuvant chemotherapy (NACT). PMID: 28361851
  • Our findings indicated that hTERT promoter-driven expression of the NIS gene in HeLa cells led to 188Re uptake and therapeutic effects. Thus, NIS-based gene therapy and imaging using the hTERT promoter and 188Re may be possible. PMID: 27573304
  • SLC5A5 was down-regulated in FTC and PTC. Its expression could be modulated by hsa-let-7f-5p. ATC showed a loss of SLC5A5/hsa-let7f-5p correlation PMID: 26960757
  • Mutating the sites located on the C-terminal domain of the protein has no effect except for the creation of a diacidic motif that decreases the total NIS protein level without affecting its expression at the plasma membrane. PMID: 26831514
  • Therefore, enhancing functional NIS by the increasing level of glycosylation may be suggested as a promising therapeutic strategy for cancer patients who show refractory response to conventional radioiodine treatment. PMID: 26599396
  • Our results confirmed that NIS overexpression enhances the sensitivity of ER-negative breast cancer cells to radioiodide therapy. PMID: 25955347
  • miR-146b-3p binds to the 3'-untranslated region of PAX8 and sodium/iodide symporter, leading to impaired protein translation and a subsequent reduction in iodide uptake. PMID: 26282166
  • Study demonstrates an association of one variant and several haplotypes of the NIS gene with differentiated thyroid cancer. PMID: 26160439
  • Data suggest that SLC5A5, SLC5A8 (sodium-coupled monocarboxylate transporter 1), and SLC26A4 (pendrin), the 3 known iodide transporters, are important in breast tissue metabolism in lactation and in breast neoplasms. [REVIEW] PMID: 26285906
  • Real time PCR revealed that both cell lines express mRNA of lactoferrin receptors while flow cytometry and confocal microscopy showed the cells efficiently internalize bLf which upregulates NIS expression. PMID: 26213306
  • Although the affinity of NIS for I- is low, it increases when Na+ is bound. NIS takes advantage of the extracellular Na+ concentration and the pronounced increase in its own affinity for I- and for the second Na+ elicited by binding of the first. PMID: 24888603
  • concluded that NIS-mediated RAIU could be modulated by miR-146b; accordingly, miR-146b might serve as one of targets to enhance efficacy of radioactive therapy against poorly differential thyroid carcinoma PMID: 25960292
  • In normal salivary gland, striated duct cells strongly expressed NIS. In Warthin's tumors, eosinophilic epithelial cells exhibited NIS expression, but expression was varied among cases. Tc-positive specimens were NIS+. Tc-negative specimens were NIS-. PMID: 25199743
  • Due to their low NIS expression, TCV and DSPTC need higher cumulative doses of radioactive iodine therapy to improve their prognosis. PMID: 24096868
  • results indicate that the NIS mutation rate is very low in the Guangxi Zhuang Region, China, and it is necessary to study mutations of other genes that have major effects on thyroid dyshormonogenesis and have not as yet been studied in this population. PMID: 25465605
  • Relatively weak melanoma-specific promoter directs high NIS activity in melanoma cell, however weaker cancer-specific promoters drive high NIS activity only in certain melanoma cell line. PMID: 25842835
  • BRAF V600E inhibited NIS expression by the upregulation of its promoter methylation. Specific regions of CpG islands of NIS promoter in BRAF V600E harboring papillary thyroid carcinoma were highly methylated compared with surrounding normal tissue. PMID: 25378232
  • Given the recent progress in the study of NIS regulation as molecular basis for new therapeutic approaches in extrathyroidal cancers. PMID: 24884806
  • The expression of TSHR and NIS genes is differently controlled by multiple mechanisms, including epigenetic events elicited by major signaling pathways involved in thyroid tumorigenesis. PMID: 24353283
  • NIS is a new ovarian cancer marker, opening a door for the use of radioiodide in the diagnosis and treatment of ovarian cancer patients. PMID: 24708099
  • this study identified a new distal enhancer, NIS distal enhancer, that regulates gene expression through DNA methylation in thyroid cancer. PMID: 24432988
  • The results suggest a a key structural role for the delta-amino group of R124 in the Na+/I- symporter's maturation and cell surface targeting. PMID: 23690546
  • NIS expression is tightly modulated during the transition of intercalated to striated ducts and striated to excretory ducts in salivary ductal cells. NIS expression in salivary glands is decreased during inflammation and tumor formation PMID: 23441638
  • Data indicate that Na+/I- symporter and type 3 iodothyronine deiodinase genes are expressed in term placenta and amniotic membrane. PMID: 23857380
  • the NIS gene is a direct target of the p53 family. PMID: 24052075
  • SLC5A5 is composed of 13 transmembrane helices and 643 amino acid residues in humans. (Review) PMID: 23988430
  • Data indicate that interhelical interaction is required for Na(+)/I(-) symporter (NIS) folding and activity. PMID: 23650190
  • Data from mutant recombinant proteins suggest that proto-oncogene PBF/PTTG1IP (pituitary tumor-transforming 1 interacting protein) is phosphoprotein and highlight importance of tyrosine residue Y174 in its interaction/co-localization with NIS. PMID: 23678037
  • MEK inhibition leads to lysosome-mediated NIS protein degradation in human breast cancer cells PMID: 23404856
  • The study indicates a positive link between hNIS and ER expression in breast cancer. PMID: 23342072
  • NIS is highly expressed in early human trophoblast at the feto-maternal interface. PMID: 23174149
  • Data indicate that MV-NIS, an oncolytic measles virus that encodes the human thyroidal sodium iodide symporter (NIS), deliver targeted radiotherapy to the tumor site and promote a localized bystander effect. above and beyond that achieved by MV alone. PMID: 23134812
  • Data from various thyroid cancer cell lines suggest that PARP (poly(ADP-ribose) polymerase) inhibition increases NIS gene expression through a particular modulation of transcriptional regulatory mechanisms (i.e., specific histone modifications). PMID: 22982218
  • Data indicate that expression of SLC5A5 in placenta is up-regulated during placentation; during the first trimester, SLC5A5 mRNA is low at 6 weeks and peaks at 12 weeks; expression of SLC5A5 protein increases with increased placental vascularization. PMID: 22954554
  • Nevirapine may induce the up-regulation of NIS mRNA and TSHR mRNA in FRO anaplastic thyroid carcinoma cells. PMID: 22781452
  • Molecular imaging of luciferase signal and sodium-iodide symporter imaging may be useful for in vivo optimization of bioenergetics in transplanted cells. PMID: 23255420
  • Sodium/iodide symporter is expressed in the majority of seminomas and embryonal testicular carcinomas. PMID: 23117572
  • our results established NIS as a carrier protein that interacts with a major cell signaling hub to facilitate tumor cell locomotion and invasion. PMID: 22962269
  • The BRAF(V600E) mutation was associated with a statistically significant lower functional NIS protein expression in the classic variant of papillary thyroid carcinomas. PMID: 23163107
  • CREM expression is increased in thyroid cancer tissue and may play a role in the downregulation of sodium iodide symporter expression in thyroid cancer acting at the transcriptional level PMID: 22510021
  • analysis of subcellular distribution of the sodium iodide symporter in benign and malignant thyroid tissues PMID: 22545753

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed