Recombinant Human Sodium/Glucose Cotransporter 2 (SLC5A2) Protein (His&Myc)

Name: Recombinant Human Sodium/Glucose Cotransporter 2 (SLC5A2) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-02285P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Sodium/Glucose Cotransporter 2 (SLC5A2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P31639
Target Symbol	SLC5A2
Synonyms	SLC5A2; SGLT2; Sodium/glucose cotransporter 2; Na(+/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Expression Range	1-102aa
Protein Length	Partial
Mol. Weight	15.5kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Subcellular Location	Membrane; Multi-pass membrane protein.
Protein Families	Sodium:solute symporter (SSF) (TC 2.A.21) family
Database References	HGNC: 11037 OMIM: 182381 KEGG: hsa:6524 STRING: 9606.ENSP00000327943 UniGene: PMID: 29205334 Sodium-glucose cotransporter-2 (SGLT2) is selectively expressed in the human kidney, where it executes reabsorption of filtered glucose with a high capacity; it may be overactive in patients with diabetes, especially in the early, hyperfiltering stage of the disease. As a therapeutic target, SGLT2 has been successfully engaged by orally active, selective agents. [review] PMID: 28506519 In this study, more than 90% of patients were on Forxiga or Invokana. Merck and Pfizer are also collaborating to bring an SGLT2 rival drug, ertugliflozin, to market as well as on two combinations containing the drug to treat type 2 diabetes. PMID: 28398306 Canagliflozin, an orally active inhibitor of sodium glucose co-transporter 2, is approved for the treatment of type-2 diabetes mellitus. Food did not affect canagliflozin pharmacokinetics. PMID: 27136908 C-peptide-based measurements of insulin secretion are appropriate for assessing beta-cell function in SGLT2 inhibitor canagliflozin-treated participants. PMID: 27127999 The novel pathogenic SLC5A2 mutation p.S293C was responsible for the onset of FRG PMID: 28365451 Molecular Interaction of Anti-Diabetic Drugs With Acetylcholinesterase and Sodium Glucose Co-Transporter 2. PMID: 28387957 the key pharmacodynamic effects of SGLT2 inhibitors and the clinical evidence that support the rationale for the use of SGLT2 inhibitors in patients with HF who have T2D. Because these favorable effects presumably occur independent of blood glucose lowering, we also explore the potential use of SGLT2 inhibition in patients without T2D with HF or at risk of HF, such as in patients with coronary artery disease PMID: 29061576 Results provide evidence that common genetic variants in the SLC5A2 gene do not affect diabetes-related metabolic traits in subjects at increased risk of type 2 diabetes. PMID: 28134748 SGLT2/MAP17 functions as a low-affinity Na(+)-glucose cotransporter in the kidney. PMID: 28592437 reported nominal effects of individual SLC5A2 variants on fasting and post-challenge glucose levels may probably not be mediated by altered glucagon release PMID: 28472182 Findings suggest that there are subtypes of T2DM characterized by different urinary glucose excretion and cardiovascular risk factors. SLC5A2 and HNF1A mutations partially explain renal glycosuria in patients with T2DM. PMID: 28324025 SGLT2 inhibitors combined with insulin might be an efficient and safe treatment modality for T1DM patients. PMID: 28399981 Data suggest that, by shunting substantial amounts of carbohydrate into urine, SGLT2-mediated glycosuria results in a progressive shift in energy metabolism toward fatty substrates; studies were conducted in subjects with/without diabetes type 2 treated with SGLT2 antagonist and hypoglycemic agent empagliflozin. PMID: 26861783 Studies indicate that Sodium-glucose cotransporter 2 (SGLT2)T2 inhibitors are promising antidiabetic agents that are gaining attention in both clinical medicine and basic research. PMID: 27754601 Data suggest that ketoacidosis (ketonuria/ketonemia) associated with the use of sodium-glucose cotransporter 2 protein (SGLT-2) inhibitors needs further research. PMID: 27085074 In both men and women, grip strength increased in both hands after sodium-glucose cotransporter 2 protein (SGLT2) inhibitor treatment . PMID: 27038414 Data suggest that SGLT2 plays central role in energy metabolism and renal elimination of circulating glucose; targeted inhibition of SGLT2 alters energy metabolism in diabetes and obesity. PMID: 26403227 Mutations in the SLC5A2 gene did not find any evidence that chronic loss of glucose in the urine would protect from deterioration of the glucose tolerance over time. PMID: 26735923 Data suggest that SGLT2 is transporter found in proximal renal tubules, responsible for reabsorption of most of glucose filtered by kidney; inhibition of SGLT2 lowers blood glucose level by promoting urinary excretion of excess glucose. [REVIEW] PMID: 26362302 Data show that thiosugars bind to sodium-glucose co-transporters vSGLT and hSGLT2 stronger and dissociate more slowly than sugars. PMID: 26260238 SGLT2 is functionally expressed in pancreatic and prostate adenocarcinomas PMID: 26170283 Results identified six SLC5A2 variants including four novel variants in Chinese familial renal glucosuria. Variant SLC5A2 proteins had altered expression levels and patterns in addition to significantly lower glucose transport in cultured cells. PMID: 25339128 SGLT2 inhibitor canagliflozin can be coadministered with oral contraceptives, warfarin, or digoxin without dose adjustments. PMID: 25345427 SGLT2 is inhibited with dapagliflozin in pancreatic alpha cells, which triggers glucagon secretion PMID: 25894829 Sodium glucose cotransporter 2 inhibitor empagliflozin is not associated with prolonged QT interval. PMID: 23617452 A single dose of canagliflozin, a sodium glucose co-transporter 2 inhibitor, 300 mg reduced both fasting and postprandial PG. PMID: 25110280 A possible role of common genetic variation in SLC5A2 in the control of glucose homeostasis. PMID: 23651029 Studies indcate that glucose is present in the glomerular filtrate and is reabsorbed by a group of transport proteins in the renal tubular epithelium, with sodium glucose transporter (SGLT)-2 quantitatively the most important. PMID: 23714218 Data suggest that SGLT2 plays role in tubular apoptosis in diabetic nephropathy; SGLT2-mediated, high glucose-induced generation of reactive oxygen species appears to augment apoptosis of renal tubular cells. PMID: 23508966 It was concluded that human SGLT1 and SGLT2 are regulated by different mechanisms and suggest that insulin is an SGLT2 agonist in vivo. PMID: 22673616 A total of 21 different SLC5A2 mutations were detected in a cohort of 23 unrelated Korean children with Familial renal glucosuria PMID: 22314875 In this review, we summarize the available data concerning the mechanism of action, efficacy, and safety of this novel antidiabetic class of therapeutic agents. PMID: 22528597 analysis of SGLT2 inhibitors containing the 1,2,3-triazole motif and evaluation of their urinary glucose excretion PMID: 22079028 TS-071 inhibited SGLT2 activity in a concentration-dependent manner. PMID: 21410690 Our data suggest a role of SGLT2 genetic variation in the regulation of glucose homeostasis and promote pharmacogenomic studies to clarify the efficacy of antidiabetic treatment by SGLT2 inhibitors PMID: 21830867 Five novel SGLT2 mutations were identified in familial renal glucosuria patients. Mutant SGLT2 proteins had significantly lower glucose transport capacity upon reconstruction in cultured cells. PMID: 21165652 SGLT2 plays an important role in renal tubular glucose reabsorption. PMID: 14569097 homozygous missense mutation in exon 8 of SLC5A2, resulting in a lysine to arginine substitution at position 321 underlies autosomal-recessive renal glucosuria and aminoaciduria PMID: 15610225 Thioglycoside I (phenyl-1'-thio-beta-D-glucopyranoside) inhibited hSGLT2. PMID: 17505558 Within 17 pedigrees, we have identified a total of 20 different SLC5A2 mutations in familial renal glucosuria. PMID: 18622023

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Sodium/Glucose Cotransporter 2 (SLC5A2) Protein (His&Myc)

Recombinant Human Sodium/Glucose Cotransporter 2 (SLC5A2) Protein (His&Myc)

Product Overview

Target Details

FAQs