Recombinant Human Sodium-Dependent Phosphate Transport Protein 2B (SLC34A2) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-03669P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Sodium-Dependent Phosphate Transport Protein 2B (SLC34A2) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-03669P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Sodium-Dependent Phosphate Transport Protein 2B (SLC34A2) Protein (His-B2M) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O95436 |
Target Symbol | SLC34A2 |
Synonyms | SLC34A2; Sodium-dependent phosphate transport protein 2B; Sodium-phosphate transport protein 2B; Na(+)-dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na(+)/Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-B2M |
Target Protein Sequence | LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA |
Expression Range | 574-689aa |
Protein Length | Partial |
Mol. Weight | 27.1 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. |
Subcellular Location | Membrane; Multi-pass membrane protein. |
Protein Families | SLC34A transporter family |
Database References | HGNC: 11020 OMIM: 265100 KEGG: hsa:10568 STRING: 9606.ENSP00000371483 UniGene: PMID: 30262706 |