Recombinant Human Small Ubiquitin-Related Modifier 4 (SUMO4) Protein (GST)

Name: Recombinant Human Small Ubiquitin-Related Modifier 4 (SUMO4) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08836P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Small Ubiquitin-Related Modifier 4 (SUMO4) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q6EEV6
Target Symbol	SUMO4
Synonyms	dJ281H8.4; IDDM5; Small ubiquitin like modifier 4 protein; Small ubiquitin-like protein 4; Small ubiquitin-related modifier 4; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3H4; SUMO 4; SUMO-4; SUMO4; SUMO4_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Expression Range	1-95aa
Protein Length	Full Length of BC130305
Mol. Weight	37.7kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I.
Protein Families	Ubiquitin family, SUMO subfamily
Database References	HGNC: 21181 OMIM: 600320 KEGG: hsa:387082 STRING: 9606.ENSP00000318635 UniGene: PMID: 28494838 Both donor and recipient SUMO4 rs237025 polymorphisms contribute to the development of new-onset diabetes mellitus after liver transplantation. PMID: 28689037 Results show that SUMO-4 is expressed in normal placental development. SUMO-4 expression was increased in pre-eclamptic placentas and in models of oxidative stress and hypoxic injury suggesting that SUMO-4 hyper-SUMOylation may be a potential post-translational mechanism in the stressed pre-eclamptic placenta. PMID: 28545138 study suggests that SUMO4 c.163 G to A polymorphism is associated with the susceptibility to diabetic nephropathy in north Indian subjects with type 2 diabetes PMID: 27055882 SUMO4 M55V polymorphism and type-2 diabetes were significantly associated with a possible SUMO4 region to type-2 diabetes susceptibility. PMID: 25189908 No association between SUMO4 gene polymorphisms and acoronary artery disease with and without type 2 diabetes mellitus. PMID: 23042402 SUMO4 Met55Val variant was associated with increased insulin resistance in Chinese patients with newly diagnosed type 2 diabetes. PMID: 21671169 study demonstrates significant associations of SUMO4 M55V polymorphism with type 1 diabetes mellitus in Asian and Caucasian population and with type 2 diabetes mellitus in Asian population PMID: 22936652 The C438T polymorphism in the SUMO4 gene is associated with significantly increased risk of papulopustular skin lesions in HLA-B51-positive Behcet's disease patients. PMID: 21901353 This meta-analysis indicates that the SUMO4 M55V polymorphism confers susceptibility to type I diabetes in Asians and Europeans. PMID: 22884980 the association between small ubiquitin-like modifier 4 (SUMO4) gene polymorphisms and type 2 diabetes mellitus PMID: 22425950 Letter: report SUMO4 polymorphisms associated with protective effect in Tunisian rheumatoid arthritis patients. PMID: 21906435 The SUMO4 gene single nucleotide polymorphism variant is not associated with susceptibility of the type 2 diabetes polymorphism. PMID: 20728233 SUMO4 gene polymorphisms may be involved in the development of skin lesions, vascular Behcet's disease, as well as the severity of the disease. PMID: 20868570 SUMO4 gene M55V variant is associated with the genetic susceptibility of type 1 diabetes mellitus (T1D) in Chinese children. PMID: 21158221 This study suggests that in Taiwan the SUMO4 Met 55Val polymorphism is associated with susceptibility to T2DM and Type 2 diabetic patients with GG genotype have worse glycemic control. PMID: 19915388 Observational study of gene-disease association. (HuGE Navigator) PMID: 20728233 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20448286 Meta-analysis of gene-disease association. (HuGE Navigator) PMID: 20518843 total of 2317 families were genotyped for 15 SNPs in the SUMO4 region. PMID: 19956095 we report evidence for an association between T1D and multiple single-nucleotide polymorphisms in 197 kb of genomic DNA in the IDDM5 interval. PMID: 15247916 SUMO4 sumoylation may play an important role in the regulation of intracellular stress PMID: 16236267 The M55V polymorphism was significantly associated with type 1 diabetes in Asian populations . PMID: 16306380 results indicate that the small ubiquitin-like protein 4(SUMO4) is a more common autoimmune disease gene and a supplementary risk factor to type 1 diabetes PMID: 16735488 SUMO4 SNP did not significantly influence predisposition to and features of rheumatoid artritis, in contrast to previous genetic and functional evidence that suggested its involvement. PMID: 16755651 Genetic and functional evidence is provided supporting SUMO4 as a type 1 diabetes mellitus susceptibility gene. PMID: 17130563 No significant association was found between SUMO4 M55V and LADA. PMID: 17130565 SUMO4 gene methionine-valine variant is associated with severity of diabetic nephropathy in patients with type 2 diabetes. PMID: 17229939 Our results show that Asian-Indians with T1DM are different from other Asian populations. Asian-Indians show more similarity to Caucasians with respect to the association of SUMO4 M55V variant in T1DM. PMID: 17373940 contribution of the SUMO4 Met55Val polymorphism to both type 1 and type 2 diabetes susceptibility in the Japanese population PMID: 17374705 SUMO4 protein appears to be either in extremely low abundance in human kidney or HEK293 cells or it is not present at all.It remains possible that SUMO4 protein is more abundant in other cell types or can be induced by hormonal or environmental challenges PMID: 17459725 we conclude that SUMO4 M55V is associated with type I diabetes melitus in association with high-risk HLA-DR3 and DR4, but not by itself. PMID: 17554341 study of the prevalence of four polymorphisms,CTLA-4 -318 C/T, 159 C/T, 3' STR and SUMO4 163 AG in latent autoimmune diabetes in adults; no association with either of the polymorphisms has been found PMID: 17558709 reported a positive association of the SUMO4 M55V variant with diabetic nephropathy in an Asian cohort of 430 patients with type 2 diabetes PMID: 17660269 data indicate that the M55V polymorphism in the small ubiquitin-like protein 4(SUMO4) gene is associated with a reduced risk of diabetic retinopathy in type 1 diabetes PMID: 17926234 we will update the genetic evidence supporting SUMO4 as a T1D susceptibility gene and discuss the possible explanations for the discrepant associations observed in Caucasians vs Asians.[review] PMID: 17990297 no associations of the SUMO4 rs237025 A>G polymorphism with the susceptibility of psoriasis were detected. PMID: 18330586 SUMO4 +438 C allele is associated with susceptibility to Behcet's Disease (BD) in HLA-B51 negative Chinese Han patients, while the AGAT haplotype is protectively associated with BD in HLA-B51 negative patients PMID: 18657476 These data not only confirmed previously published data, but also provided additional evidence suggesting a role for SUMO4 sumoylation in the regulation of intracellular stress. PMID: 18708028 This study examines whether small ubiquitin-like modifier 4 (SUMO4) polymorphisms were associated with Vogt-Koyanagi-Harada (VKH) syndrome in the Chinese Han population. PMID: 19122825 SUMO4 may act as a negative feedback regulator to prevent excessive activation of NFkappaB. PMID: 19222990 Association of the polymorphism of SUMO4 with risk of coronary heart disease in type 2 diabetes is suggested. PMID: 19410319 Observational study of gene-disease association. (HuGE Navigator) PMID: 19915388 Observational study of gene-disease association. (HuGE Navigator) PMID: 19410319 Observational study of gene-disease association. (HuGE Navigator) PMID: 19122825 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 18466472 Observational study of gene-disease association. (HuGE Navigator) PMID: 18466531 Observational study of gene-disease association. (HuGE Navigator) PMID: 18330586 Observational study of gene-disease association. (HuGE Navigator) PMID: 12901503 Observational study of gene-disease association. (HuGE Navigator) PMID: 15730420

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.