Recombinant Human Small Proline-Rich Protein 3 (SPRR3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04169P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Small Proline-Rich Protein 3 (SPRR3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04169P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Small Proline-Rich Protein 3 (SPRR3) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9UBC9
Target Symbol SPRR3
Synonyms 22 kDa pancornulin; Cornifin beta; Esophagin; Small proline rich protein 3; Small proline-rich protein 3; SPRC; Sprr3; SPRR3_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Expression Range 2-169aa
Protein Length Full Length of Mature Protein
Mol. Weight 34.0kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Cross-linked envelope protein of keratinocytes.
Subcellular Location Cytoplasm.
Protein Families Cornifin (SPRR) family
Database References

HGNC: 11268

OMIM: 182271

KEGG: hsa:6707

STRING: 9606.ENSP00000295367

UniGene: PMID: 27304082

  • Results implicate that SPRR3 might serve as a radiation-sensitive predictor of ESCC. PMID: 23820115
  • This study demonstrates that SPRR3 promotes BC cell proliferation by enhancing p53 degradation via the AKT and MAPK pathways PMID: 22076481
  • The quantitative analysis of SPRR3 mRNA is a robust and reliable method to monitor the malignant transformation of the healthy esophageal mucosa into esophageal squamous cell carcinoma. PMID: 21777580
  • The SPRR3 variant associated with eczema carried an extra 24-bp repeat in the central domain, which may alter the physical properties of the cornified cell envelope PMID: 21490620
  • Results suggest that increased expression of SPRR3 is involved in colorectal tumorigenesis. PMID: 20379613
  • two isoforms of SPRR3 were characterized from saliva of preterm human newborn and autoptic fetal oral mucosa, parotid and submandibular gland samples. PMID: 20599699
  • Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points. PMID: 19211270
  • SPR3 transcripts were significantly increased in human papillomavirus 11-infected tissues and minimally increased in human papillomavirus 59-infected tissues PMID: 14748073
  • A marker of human esophageal neoplastic progression PMID: 15221970
  • Esophagin/SPRR3 may play a role in the maintenance of normal esophageal epithelial homeostasis, and aberrant expression of Esophagin/SPRR3 may contribute to the tumorigenesis of esophageal squamous cell carcinoma PMID: 17935133
  • These data suggest that SPRR3 may play a role in vascular smooth muscle cells adaptation to local biomechanical stress within the plaque microenvironment. PMID: 18832573

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed