Recombinant Human Small Nuclear Ribonucleoprotein Sm D2 (SNRPD2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08481P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Small Nuclear Ribonucleoprotein Sm D2 (SNRPD2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08481P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Small Nuclear Ribonucleoprotein Sm D2 (SNRPD2) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P62316 |
| Target Symbol | SNRPD2 |
| Synonyms | Sm-D2; small nuclear ribonucleoprotein D2; Small nuclear ribonucleoprotein D2 (RCG54604); small nuclear ribonucleoprotein D2 polypeptide (16.5kD); small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; SMALL NUCLEAR RIBONUCLEOPROTEIN POLYPEPTIDE D2, SNRPD2; Small nuclear ribonucleoprotein Sm D2; SMD2; SMD2_HUMAN; snRNP core protein D2; SNRPD1; Snrpd2; SNRPD2 small nuclear ribonucleoprotein D2 polypeptide 16.5kDa |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK |
| Expression Range | 1-118aa |
| Protein Length | Full Length |
| Mol. Weight | 40.5kDa |
| Research Area | Transcription |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. |
| Subcellular Location | Cytoplasm, cytosol. Nucleus. |
| Protein Families | SnRNP core protein family |
| Database References |
