Recombinant Human SLC35F3 Protein (N-10xHis & C-Myc)
Beta LifeScience
SKU/CAT #: BLC-11431P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human SLC35F3 Protein (N-10xHis & C-Myc)
Beta LifeScience
SKU/CAT #: BLC-11431P
Regular price
$94900
$949.00
Sale price$9900
$99.00Save $850
/
Product Overview
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q8IY50 |
Target Symbol | SLC35F3 |
Species | Human |
Expression System | E.coli |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Target Protein Sequence | MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKI |
Expression Range | 1-66aa |
Protein Length | Partial |
Mol. Weight | 14.5 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Function | May be a thiamine transporter. |
Subcellular Location | Membrane; Multi-pass membrane protein. |
Protein Families | SLC35F solute transporter family |
Database References |
HGNC: 23616 KEGG: hsa:148641 UniGene: Hs.158748 |