Recombinant Human SLC10A1 Protein (N-MBP & C-6xHis-Avi)
Beta LifeScience
SKU/CAT #: BLC-11421P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human SLC10A1 Protein (N-MBP & C-6xHis-Avi)
Beta LifeScience
SKU/CAT #: BLC-11421P
Regular price
$94900
$949.00
Sale price$24000
$240.00Save $709
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q14973 |
| Target Symbol | SLC10A1 |
| Species | Human |
| Expression System | E.coli |
| Tag | N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged |
| Target Protein Sequence | FWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA |
| Expression Range | 304-349aa |
| Protein Length | Partial |
| Mol. Weight | 52.9 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Target Function | The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.; (Microbial infection) Acts as a receptor for hepatitis B virus. |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
| Protein Families | Bile acid:sodium symporter (BASS) (TC 2.A.28) family |
| Database References |
HGNC: 10905 OMIM: 182396 KEGG: hsa:6554 STRING: 9606.ENSP00000216540 UniGene: Hs.952 |
