Recombinant Human Single-Strand Selective Monofunctional Uracil Dna Glycosylase (SMUG1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03206P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Single-Strand Selective Monofunctional Uracil Dna Glycosylase (SMUG1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03206P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Single-Strand Selective Monofunctional Uracil Dna Glycosylase (SMUG1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q53HV7 |
| Target Symbol | SMUG1 |
| Synonyms | FDG; HMUDG; MGC104370; Single strand selective monofunctional uracil DNA glycosylase 1; Single strand selective monofunctional uracil DNA glycosylase; Single-strand selective monofunctional uracil DNA glycosylase; SMUG 1; Smug1; SMUG1 protein; SMUG1_HUMAN; UNG 3; UNG3 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL |
| Expression Range | 1-177aa |
| Protein Length | Full Length of Isoform 2 |
| Mol. Weight | 35.6kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward mismatches (U/G) compared to matches (U/A). Excises uracil (U), 5-formyluracil (fU) and uracil derivatives bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU)] in ssDNA and dsDNA, but not analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. The activity is damage-specific and salt-dependent. The substrate preference is the following: ssDNA > dsDNA (G pair) = dsDNA (A pair) at low salt concentration, and dsDNA (G pair) > dsDNA (A pair) > ssDNA at high salt concentration. |
| Subcellular Location | Nucleus. |
| Protein Families | Uracil-DNA glycosylase (UDG) superfamily, SMUG1 family |
| Database References | HGNC: 17148 OMIM: 607753 KEGG: hsa:23583 STRING: 9606.ENSP00000338606 UniGene: PMID: 27909884 |
