Recombinant Human Signal Transducer Cd24 (CD24) Protein (GST)

Name: Recombinant Human Signal Transducer Cd24 (CD24) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-02336P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Signal Transducer Cd24 (CD24) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P25063
Target Symbol	CD24
Synonyms	CD 24; CD24; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 antigen; CD24 molecule; CD24_HUMAN; CD24A; FLJ22950; FLJ43543; GPI linked surface mucin; Heat stable antigen; HSA; MGC75043; Nectadrin; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Expression Range	27-80aa
Protein Length	Full Length of Mature Protein
Mol. Weight	32.3kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families	CD24 family
Database References	HGNC: 1645 OMIM: 126200 KEGG: hsa:100133941 UniGene: PMID: 30297396 CD24, a cell surface receptor enriched in both juvenile chondrocytes and human induced pluripotent stem cells-derived chondrocytes, is a regulatory factor in both faster proliferation and resistance to proinflammatory cues in these chondrocyte populations. PMID: 29096706 based on our data, the markers CD44 and CD24 do not reflect the features of CSC and unfavorable prognosis and do not clarify the role and clinical significance of the immunophenotype CD44+/CD24-. PMID: 28967636 CD24 and CD44 are upregulated in human pancreatic cancer compared to chronic pancreatitis and may be related to the development of pancreatic cancer. PMID: 28659655 Both in vitro and in vivo studies show that cells with CD24-knockdown are more sensitive to docetaxel, while CD24-overexpressing cells are more sensitive to doxorubicin PMID: 28418843 We believe that CD24 is a key molecule of metastatic progression in the epithelial-mesenchymal-transition phenomenon and a promising therapeutic target for advanced ovarian cancer. PMID: 28440503 CD133+CD24lo phenotype defines 5-FU-resistant human colon cancer stem cell-like cells. PMID: 27659530 Our results suggest that higher CD24 expression is significantly associated with lower OS rate, lower DFS rate and some clinicopathological factors such as lymph node invasion and TNM stage. This meta-analysis suggested that CD24 is an efficient prognostic factor in breast cancer PMID: 28315505 G7mAb was an anti-CD24 antibody. PMID: 28391164 CD44 and CD24 collaboratively drive the reprogramming of nasopharyngeal carcinoma cells through STAT3-mediated stemness and epithelial-mesenchymal transition activation PMID: 27521216 The increase in CD19+CD24+CD27+ Bregs was closely associated with fasting insulin secretion. PMID: 28440417 CD24 induced colorectal cancer angiogenesis in Hsp90-dependent manner and activated STAT3-mediated transcription of VEGF. PMID: 27494878 Study have shown that CD24 is highly expressed in a bone metastatic lung cancer cell line, promotes anchorage-independent growth and adhesion in vitro, and that CD24-knockdown suppressed bone metastasis of lung cancer cells in vivo. PMID: 29095550 Silencing of CD24 enhanced restoration of PRIMA-1-induced mutant p53 in endogenous TP53(P223L/V274F) DU145 cells. PMID: 26712693 CD44 and CD24 were not found to predict overall survival or disease-free survival in colonic liver metastases. PMID: 29277789 CD24+ tumorigenic cells with angiogenic potential were isolated from oral squamous cell carcinomas. PMID: 28344048 We have identified CD24 as a novel regulator of inflammatory response in cartilage that is altered during development and aging PMID: 27955675 High nuclear CD24 expression in stromal cells is associated with bladder cancer. PMID: 28674079 While no obvious role was found for CD24 in the normal development and maintenance of the dopaminergic nigrostriatal system in mice, it may have a role in mediating the neuroprotective aspects of GDNF in this system. PMID: 28182766 Expression of CDH1 and CD24 was transcriptionally upregulated by direct binding of HOXA5 to their promoter sequences as demonstrated by luciferase and ChIP analyses PMID: 27157614 notochord-specific marker during early intervertebral disc development PMID: 26910849 CD24 is a highly sensitive and specific marker of ovarian carcinoma in the differential diagnosis from malignant mesothelioma and reactive mesothelium in effusions. PMID: 27589896 These data suggest a significant association of CD24 genetic variants with prostate cancer onset and progression, which provides new insight into molecular genetics of prostate cancer. PMID: 27377469 Data show that CD44bright/CD24dim and CD44bright/CD24bright correspond to epithelioid and fibroblastoid subsets, respectively. PMID: 28121626 CD24 cell surface expression may serve as a valuable biomarker in order to identify mammary tumors that will positively respond to targeted IGF1R therapies. PMID: 27179633 co-expression of CD90 and CD24 may have an important role in the development and progression of pancreatic intraepithelial neoplasia. PMID: 27332878 CD24 expression level directly affects cisplatin sensitivity and affects the expression of critical apoptotic, stem and drug resistance genes. PMID: 27276062 CD44+/24- and ALDH1-positive rates in primary tumors differed according to intrinsic subtype. ER-positive patients with CD44+/24- tumors had significantly longer disease-free-survival than all other ER-positive patients PMID: 27768764 CD44+/CD24- cells were present in all tumor tissues. The percentage of CD44+/CD24- cells was higher in early-stage disease, but without statistical significance. PMID: 27837613 Increased expression of CD24 may be associated with tumor progression and prognosis in patients with uterine cervical cancer. PMID: 26351781 High CD24 expression is associated with breast neoplasms. PMID: 27470135 The early stage of root development demonstrated higher CD24 expressing cells than later stage. In conclusion, quantity of CD24 expressing cells influenced SCAPs self-renewal and multi-lineage differentiation but did not influence on cell proliferation. PMID: 27613575 These results reveal the underlying link between the HCC processes mediated by CD24. Moreover, as a clear tumor promoter, CD24 is considered a potential new target for HCC treatment. PMID: 26608371 Of the 66 apocrine lesions, 62 (94 %) did not express C-KIT compared to 4/63 (6 %) of the normal glands PMID: 27287269 In this work, we analyzed the expression of CD133, FOXP3, ABCG2 and CD24 in women affected by vulvar cancer, correlating these with common clinical prognostic factors PMID: 27798870 The P-534 site in CD24 gene affects the overall survival of gastric cancer and may serve as a prognostic marker for gastric cancer. PMID: 26900300 Discussion of the roles of CD24 including the effects of CD24 gene polymorphisms on the risk of developing autoimmune diseases (review). PMID: 25666875 our results suggest that CD24 is upregulated in cervical cancer tissues and plays its functions by affecting the MAPK signaling pathway in cervical cancer. PMID: 26707501 The frequencies of CD19+CD24hiCD38hi B-regulatory lymphocyte were significantly increased in children with beta-thalassemia. PMID: 26852663 CD24 regulates EGFR signaling by inhibiting EGFR internalization and degradation in a RhoA-dependent manner in gastric cancer cells. PMID: 26830684 Suggest CD24 expression as independent prognostic factor in colorectal carcinoma. PMID: 26097606 CD44(+)/CD24(-) phenotype may be an important factor for malignant relapse following surgical resection and chemotherapy in patients with invasive ductal carcinoma. PMID: 26617852 we present evidence that CD44v3 immunoexpression and CD44v3+/CD24- immunophenotypes could give prognostic information associated with unfavorable clinical outcomes. PMID: 26647656 Increased CD24 gene expression is associated with pediatric medulloblastomas. PMID: 25820321 The functional CD24 A57V and TG/del polymorphisms are associated with susceptibility to multiple autoimmune diseases. (Meta-analysis) PMID: 26718436 Basal like tumors are enriched for cancer stem cells (CSC) with CD44(+)/CD24(-/low) phenotype. CD133 can detect a different population of CSC in breast carcinoma PMID: 26298632 The CD24-positive phenotype is associated with cisplatin resistance in endometrial cancer tumor xenografts and is accompanied by high expression of ABC transporters. PMID: 26227486 Reduced CD24 expression decreases oxidative stress and genomic instability. PMID: 25641732 CD24 A1626 G is more frequent in OLP patients, contributes to disease risk, and could play a role in OLP susceptibility. PMID: 26187149 CD24 gene expression was associated with histone acetylation. PMID: 26444008

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.