Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04335P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) STAT3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) STAT3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) STAT3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) STAT3.

Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04335P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Signal Transducer And Activator Of Transcription 3 (STAT3) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P40763
Target Symbol STAT3
Synonyms 1110034C02Rik; Acute Phase Response Factor; Acute-phase response factor; ADMIO; APRF; AW109958; DNA binding protein APRF; FLJ20882; HIES; MGC16063; Signal transducer and activator of transcription 3 (acute phase response factor); Signal transducer and activator of transcription 3; STAT 3; Stat3; STAT3_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
Expression Range 50-240aa
Protein Length Partial
Mol. Weight 38.3kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors. Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Upon activation of IL6ST/gp130 signaling by interleukin-6 (IL6), binds to the IL6-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA. Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): deacetylation and oxidation of lysine residues by LOXL3, leads to disrupt STAT3 dimerization and inhibit its transcription activity. Involved in cell cycle regulation by inducing the expression of key genes for the progression from G1 to S phase, such as CCND1. Mediates the effects of LEP on melanocortin production, body energy homeostasis and lactation. May play an apoptotic role by transctivating BIRC5 expression under LEP activation. Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity. Plays a crucial role in basal beta cell functions, such as regulation of insulin secretion.
Subcellular Location Cytoplasm. Nucleus. Note=Shuttles between the nucleus and the cytoplasm. Translocated into the nucleus upon tyrosine phosphorylation and dimerization, in response to signaling by activated FGFR1, FGFR2, FGFR3 or FGFR4. Constitutive nuclear presence is independent of tyrosine phosphorylation. Predominantly present in the cytoplasm without stimuli. Upon leukemia inhibitory factor (LIF) stimulation, accumulates in the nucleus. The complex composed of BART and ARL2 plays an important role in the nuclear translocation and retention of STAT3. Identified in a complex with LYN and PAG1.
Protein Families Transcription factor STAT family
Database References

HGNC: 11364

OMIM: 102582

KEGG: hsa:6774

STRING: 9606.ENSP00000264657

UniGene: PMID: 30365149

  • an HBV-pSTAT3-SALL4-miR-200c axis regulates PD-L1 causing T cell exhaustion PMID: 29593314
  • reveal that breast cancer stem cell (BCSC) in triple-negative breast cancer depend on the transcription regulator HN1L for the sustained activation of the LEPR-STAT3 pathway, which makes it a potentially important target for both prognosis and BCSC therapy. PMID: 29249663
  • findings illustrate the significance of CREB-KDM4B-STAT3 signaling cascade in DNA damage response, and highlight that KDM4B may potentially be a novel oncotarget for colorectal cancer radiotherapy. PMID: 29633065
  • TNFRSF1A is a STAT3 target gene that regulates the NF-kappaB pathway. PMID: 29621649
  • Downregulation of miR-340 inhibited GC cell proliferation, arrested cell cycle, and facilitated apoptosis through upregulating SOCS3 expression to suppress JAK-STAT3 signaling pathway. PMID: 29658372
  • we wanted to explore whether STAT3 can be related to lymph node micrometastasis of non-small cell lung cancer (NSCLC). To address this question, we evaluated the expression of MUC1 mRNA in the lymph node samples of NSCLC to determine micrometastasis. Then, we evaluated what role STAT3 overexpression plays in lymph node micrometastasis of NSCLC. PMID: 29575778
  • Our results showed that IL-37 plays an inhibitory role in non-small cell lung cancer progression, possibly by suppressing STAT3 activation and decreasing epithelial-to-mesenchymal transition by inhibiting IL-6 expression. IL-37 could serve as a potential novel tumor suppressor in non-small cell lung cancer PMID: 29575809
  • Study shows that vascular endothelial growth factor A stimulates STAT3 activity via nitrosylation of myocardin to regulate the expression of vascular smooth muscle cell differentiation markers. PMID: 28572685
  • The investigation demonstrated that the serum levels of FGF23 and the phosphorylation levels of JAK2, STAT1, and STAT3 were up-regulated in the ovariectomy (OVX) + NVP-BGJ398 group while were down-regulated in the OVX + Anti-FGF23 group than that in the OVX group. PMID: 28782829
  • Genetic or pharmacologic inactivation of SHP2 promotes accumulation of JAK2 phosphorylated at Y570, reduces JAK2/STAT3 signaling, inhibits TGFbeta-induced fibroblast activation and ameliorates dermal and pulmonary fibrosis. PMID: 30108215
  • Mir-204 attenuates angiogenesis in lung adenocarcinoma via JAK2-STAT3 pathway. PMID: 29281186
  • Study utilizing integrative analysis of transcriptomic, metabolomic, and clinical data propose a model of GOT2 transcriptional regulation, in which the cooperative phosphorylation of STAT3 and direct joint binding of STAT3 and p65/NF-kappaB to the proximal GOT2 promoter are important. PMID: 29666362
  • FEZF1-AS1 acts as an oncogenic lncRNA in human hepatocellular carcinoma by promoting JAK2/STAT3 signaling-mediated epithelial mesenchymal transformation. PMID: 29957463
  • FABP5 promotes tumor angiogenesis via activation of the IL6/STAT3/VEGFA signaling pathway in hepatocellular carcinoma. PMID: 29957468
  • The result of our study for the first time provides evidence that rs1053004 polymorphism is significantly associated with a decreased risk of Cardiopulmonary bypass-associated acute kidney injury in Iranian population, especially in older subjects. PMID: 29846833
  • Simultaneous inactivation of EAF2 and p53 can act to activate STAT3 and drive prostate tumorigenesis. PMID: 29518696
  • a transcription-independent mechanism for Stat3-mediated centrosome clustering that involves Stathmin, a Stat3 interactor involved in microtubule depolymerization, and the mitotic kinase PLK1, is reported. PMID: 28474672
  • This review discusses the upstream activators of STAT3 in skeletal muscles, with a focus on interleukin 6 (IL6) and transforming growth factor beta 1 (TGF-beta1). PMID: 30072615
  • High STAT3 expression is associated with lung adenocarcinoma. PMID: 30015929
  • JAK2 and STAT3 are activated in Idiopathic pulmonary fibrosis PMID: 29409529
  • The results reveal that the EGF-STAT3 signaling pathway promotes and maintains colorectal cancer (CRC)stemness. In addition, a crosstalk between STAT3 and Wnt activates the Wnt/beta-catenin signaling pathway, which is also responsible for cancer stemness. Thus, STAT3 is a putative therapeutic target for CRC treatment. PMID: 30068339
  • MiR-29a down-regulation is correlated with drug resistance of nasopharyngeal carcinoma cell line CNE-1 and MiR-29a up-regulation decreases Taxol resistance of nasopharyngeal carcinoma CNE-1 cells possibly via inhibiting STAT3 and Bcl-2 expression. PMID: 29914005
  • Kidney biopsies from patients with IgA nephropathy and diabetic nephropathy exhibited substantial activation of p53 and STAT3, decreased expression of SOCS7, and increase in profibrotic proteins and miR-199a-3p. PMID: 28240316
  • Low-dose radiation decreases tumor progression via the inhibition of the JAK1/STAT3 signaling axis in breast cancer cell lines and in a mouse xenograft model. PMID: 28240233
  • High STAT3 expression is associated with cell growth, aggressiveness, metastasis in gastric cancer. PMID: 30015981
  • High expression of iNOS and STAT3 in cells transfected with miR-34a mimic further validated it. PMID: 30021364
  • Findings outlined in the current study demonstrated that the inhibition of P16 decreased the growth and metastasis potential of BC cells by inhibiting IL-6/JAK2/STAT3 signaling. PMID: 29388151
  • G6PD contributes to HCC migration and invasion of hepatocellular carcinoma cells by inducing epithelial-mesenchymal transition through activation of signal transducer and activator of transcription 3 PMID: 29471502
  • CXCR7 silencing inhibits the migration and invasion of human tumor endothelial cells derived from hepatocellular carcinoma by suppressing STAT3. PMID: 29901083
  • These data show that activated p-STAT3 upregulates epithelial-to-mesenchymal transition-related proteins and promotes vasculogenic mimicry. PMID: 29333928
  • High STAT3 expression is associated with drug resistance in Chronic myeloid leukemia. PMID: 29936783
  • Case Report: breast implant-associated anaplastic large cell lymphoma with dual JAK1/STAT3 mutations. PMID: 29637270
  • Data indicate that signal transducer and activator of transcription 3 (STAT3) has emerged as a promising target in cancer immunotherapy [Review]. PMID: 29222039
  • Downregulation of the lincRNA of the NED25 gene was associated with sepsis in patients by modulating the signaling pathways downstream of miR-125b/STAT3/PCT/NO signaling pathway. PMID: 29962507
  • High STAT3 expression is associated with invasion and lymph node metastasis in gastric cancer. PMID: 29970682
  • The present study demonstrated that the downregulation of filaggrin in the epidermis by toluene is mediated by ERK1/2 and STAT3-dependent pathways. PMID: 27498358
  • these results indicated that STAT3-mediated downexpression of miR-579-3p caused resistance to vemurafenib. Our findings suggest novel approaches to overcome resistance to vemurafenib by combining vemurafenib with STAT3 sliencing or miR-579-3p overexpression. PMID: 30010109
  • Our study identified the STAT3 rs1053004 C/C as a high-risk genotype in MA (MISSED ABORTION) with lower survivin and VEGF transcription levels in the peripheral blood PMID: 30226700
  • The role of mitochondrial Stat3 as regulator for lymphocyte function is reviewed. PMID: 29866996
  • addition of colivelin, a STAT3 activator, instead of IL-6 and C2C12 conditioned medium, promoted the myogenic differentiation of adipose tissue-derived stem cells. PMID: 29882916
  • These results suggested that stemness induction in SKOV3 cells by macrophages co-cultured with SKOV3-derived OCSLCs involved IL-8/STAT3 signaling. PMID: 29656182
  • Parthenolide also induced reactive oxygen species (ROS), but the increased ROS did not seem to contribute to the inhibition of JAK/STAT3 signaling. PMID: 29921758
  • The phosphor STAT3 expression was associated with adverse survival in squamous cell carcinoma, but not in the oesophageal adenocarcinoma patients. PMID: 29890775
  • In Ishikawa human endometrial adenocarcinoma cell line MIG-6 negatively regulates the phosphorylation of STAT3 via direct protein interaction with STAT3. PMID: 28925396
  • IL-23 binding to its receptor promotes the migration and invasion of gastric cancer cells by inducing epithelial-to-mesenchymal transition through the STAT3 signaling pathway. PMID: 29574157
  • Oct4 plays a vital role in the malignant progression of HCC cells through the survivin/STAT3 signaling pathway. PMID: 29901157
  • our data demonstrate that hypoxia strongly potentiates the peroxide-mediated induction of hepcidin via STAT3 signaling pathway. Moreover, oxidases such as NOX4 or artificially overexpressed urate oxidase (UOX) can induce hepcidin PMID: 29459227
  • a novel signal circuit of Stat3/Oct-4/c-Myc was identified for regulating stemness-mediated Doxorubicin resistance in triple-negative breast cancer PMID: 29750424
  • Data show that knockdown of STAT transcription factors STAT3 and/or STAT5 reduces DNA methylcytosine dioxygenase Ten-eleven translocation 1 (TET1) level. PMID: 29235481
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed