Recombinant Human Sh3 And Px Domain-Containing Protein 2A (SH3PXD2A) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02501P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Sh3 And Px Domain-Containing Protein 2A (SH3PXD2A) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02501P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Sh3 And Px Domain-Containing Protein 2A (SH3PXD2A) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q5TCZ1 |
| Target Symbol | SH3PXD2A |
| Synonyms | Adapter protein TKS5; Five SH3 domain-containing protein; SH3 and PX domain-containing protein 2A; SH3 multiple domains protein 1; Sh3md1; Sh3pxd2a; SPD2A_HUMAN; TKs5; Tyrosine kinase substrate with five SH3 domains |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP |
| Expression Range | 902-986aa |
| Protein Length | Partial |
| Mol. Weight | 14.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Adapter protein involved in invadopodia and podosome formation, extracellular matrix degradation and invasiveness of some cancer cells. Binds matrix metalloproteinases (ADAMs), NADPH oxidases (NOXs) and phosphoinositides. Acts as an organizer protein that allows NOX1- or NOX3-dependent reactive oxygen species (ROS) generation and ROS localization. In association with ADAM12, mediates the neurotoxic effect of amyloid-beta peptide. |
| Subcellular Location | Cytoplasm. Cell projection, podosome. Note=Cytoplasmic in normal cells and localizes to podosomes in SRC-transformed cells. |
| Protein Families | SH3PXD2 family |
| Database References | HGNC: 23664 KEGG: hsa:9644 STRING: 9606.ENSP00000348215 UniGene: PMID: 27835612 |
