Recombinant Human Seryl-Trna Synthetase,Cytoplasmic Domain Protein (SARS) Protein (GST)

Name: Recombinant Human Seryl-Trna Synthetase,Cytoplasmic Domain Protein (SARS) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08451P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Seryl-Trna Synthetase,Cytoplasmic Domain Protein (SARS) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P49591
Target Symbol	SARS
Synonyms	C78314; cytoplasmic; EC 6.1.1.11; FLJ36399; sarS; Sars1; Serine tRNA ligase 1, cytoplasmic; Serine tRNA ligase; Serine--tRNA ligase; serine--tRNA ligase, cytoplasmic; SerRS; SERS; Seryl tRNA Ser/Sec synthetase; Seryl tRNA synthetase; Seryl tRNA synthetase cytoplasmic; Seryl-tRNA Ser/Sec synthetase; Seryl-tRNA synthetase; seryl-tRNA synthetase, cytoplasmic; Seryl-tRNA(Ser/Sec) synthetase; Strs; SYSC_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV
Expression Range	2-233aa
Protein Length	Partial
Mol. Weight	53.4kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction: serine is first activated by ATP to form Ser-AMP and then transferred to the acceptor end of tRNA(Ser). Is probably also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec). In the nucleus, binds to the VEGFA core promoter and prevents MYC binding and transcriptional activation by MYC. Recruits SIRT2 to the VEGFA promoter, promoting deacetylation of histone H4 at 'Lys-16' (H4K16). Thereby, inhibits the production of VEGFA and sprouting angiogenesis mediated by VEGFA.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	Class-II aminoacyl-tRNA synthetase family, Type-1 seryl-tRNA synthetase subfamily
Database References	HGNC: 10537 OMIM: 607529 KEGG: hsa:6301 STRING: 9606.ENSP00000234677 UniGene: PMID: 28236339 Analyzed the ability of cytosolic SerRS to bind and act on tRNA(Ser), tRNA(Sec), and 10 mutant and chimeric constructs in which elements of tRNA(Ser) were transposed onto tRNA(Sec). We show that SerRS only subtly prefers tRNA(Ser) to tRNA(Sec), and that discrimination occurs at the level of the serylation reaction. PMID: 28808125 Yin Yang 1 (YY1) interacts with Seryl-tRNA synthetase (SerRS) to form a SerRS/YY1 complex which functions as a negative effector to regulate vegfa transcription through binding a distal segment of the vegfa promoter, while NFKB1 serves as a positive effector through outcompeting SerRS/YY1 for binding at the same distal segment. PMID: 27913726 tRNA recognition mode of SerRS. PMID: 26433229 Several data support that p.R402H mutation in SARS2 is a new cause of HUPRA syndrome. PMID: 24034276 A long-range conformational and functional communication specific to higher eukaryotes is found in human SerRS. PMID: 24095058 study identified a nuclear localization signal sequence embedded in UNE-S domain and showed that the essential role of SerRS in vascular development is dependent on UNE-S and its role to mobilize SerRS from the cytoplasm to the nucleus PMID: 22353712 Mutations in the mitochondrial seryl-tRNA synthetase cause hyperuricemia, pulmonary hypertension, renal failure in infancy and alkalosis, HUPRA syndrome. PMID: 21255763 Recombinant human cytosolic seryl-tRNA synthetase protein was purified to homogeneity and crystallized. Diffraction data were collected to 3.13 A resolution. PMID: 21045311 SARS regulates endothelial sprouting. These analyses of zebrafish and human endothelial cells reveal a new noncanonical function of Sars in endothelial development. PMID: 19423847

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.