Recombinant Human Serpin A9 (SERPINA9) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08810P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Serpin A9 (SERPINA9) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08810P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Serpin A9 (SERPINA9) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q86WD7 |
Target Symbol | SERPINA9 |
Synonyms | Centerin; GCET1; Germinal center B cell expressed transcript 1; Germinal center B-cell-expressed transcript 1 protein; Seprin A9; Serine proteinase inhibitor A11; Serpin A9; Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 9; Serpin peptidase inhibitor clade A member 9; SERPINA11; SERPINA11b; Serpina9; SPA9_HUMAN |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | ANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS |
Expression Range | 24-417aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 49.1 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro). |
Subcellular Location | [Isoform 1]: Secreted.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 4]: Cytoplasm.; [Isoform 5]: Cytoplasm.; [Isoform 6]: Cytoplasm.; [Isoform 7]: Membrane; Single-pass type II membrane protein. |
Protein Families | Serpin family |
Database References | |
Tissue Specificity | Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies. |
Gene Functions References
- Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms. PMID: 25203428
- Results report the cloning of germinal center B-cell expressed transcripts 1 and 2 (GCET1 and 2), and show that both are expressed in follicular lymphoma and diffuse large B-cell lymphoma with germinal center B-cell differentiation. PMID: 12819018
- The cloning, expression and molecular characterization of recombinant serpina9 (centerin) are reported. PMID: 17447896
- Gcet-1 protein expression is restricted to a subset of germinal center B cells, establishing the existence of a distinct heterogeneity among normal and neoplastic germinal center B cells PMID: 17898315
- Immunohistochemical expression of centerin further defines the germinal center cell origin of a subgroup of lymphomas. PMID: 18550480
- serpinA9 was associated with stroke in both whites and blacks PMID: 18799872
- Observational study of gene-disease association. (HuGE Navigator) PMID: 19023099
- Observational study of gene-disease association. (HuGE Navigator) PMID: 17975119