Recombinant Human Serine/Threonine-Protein Phosphatase 2A Catalytic Subunit Beta Isoform (PPP2CB) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08522P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Serine/Threonine-Protein Phosphatase 2A Catalytic Subunit Beta Isoform (PPP2CB) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08522P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Serine/Threonine-Protein Phosphatase 2A Catalytic Subunit Beta Isoform (PPP2CB) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P62714 |
| Target Symbol | PPP2CB |
| Synonyms | PP2A beta; PP2A-beta; PP2AB_HUMAN; PP2Abeta; PP2CB; Ppp2cb; Protein phosphatase 2 (formerly 2A); catalytic subunit; beta isoform; Protein phosphatase 2 catalytic subunit beta isozyme; Protein phosphatase 2; catalytic subunit; beta isoform; Protein phosphatase 2A catalytic subunit beta isoform; Protein phosphatase type 2A catalytic subunit; Serine/threonine protein phosphatase 2A catalytic subunit beta; Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
| Expression Range | 1-309aa |
| Protein Length | Full Length |
| Mol. Weight | 62.6kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. |
| Subcellular Location | Cytoplasm. Nucleus. Chromosome, centromere. Cytoplasm, cytoskeleton, spindle pole. Note=In prometaphase cells, but not in anaphase cells, localizes at centromeres. During mitosis, also found at spindle poles. |
| Protein Families | PPP phosphatase family, PP-1 subfamily |
| Database References | HGNC: 9300 OMIM: 176916 KEGG: hsa:5516 STRING: 9606.ENSP00000221138 UniGene: PMID: 21317290 |
